DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and Rcvrn

DIOPT Version :10

Sequence 1:NP_524874.2 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_033064.1 Gene:Rcvrn / 19674 MGIID:97883 Length:202 Species:Mus musculus


Alignment Length:185 Identity:49/185 - (26%)
Similarity:87/185 - (47%) Gaps:26/185 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETS--------LPMEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSL-----PELQQN 52
            |||..|        ..:::.:.|..:|:....:.|  |....||.::..||.|:     |:....
Mouse     1 MGNSKSGALSKEILEELQLNTKFTEEELSAWYQSF--LKECPSGRITRQEFESIYSKFFPDSDPK 63

  Fly    53 PLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVL- 116
            ...|.|...|||:.:|.:||||::..: ..:..|....||.:||.:||:|.:|.||..|:.::: 
Mouse    64 AYAQHVFRSFDANSDGTLDFKEYVIAL-HMTTAGKPTQKLEWAFSLYDVDGNGTISKNEVLEIVM 127

  Fly   117 ---KMMVGNNLK-----DTQLQQIVDKTIGFADKDEDGKISFDEFC-SVVGNTDI 162
               ||:...::|     :...::..:|...|..|.||.|::.:||. ..:.|.:|
Mouse   128 AIFKMIKPEDVKLLPDDENTPEKRAEKIWAFFGKKEDDKLTEEEFIEGTLANKEI 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_524874.2 FRQ1 20..157 CDD:444056 41/151 (27%)
RcvrnNP_033064.1 FRQ1 41..175 CDD:444056 39/134 (29%)
Interaction with GRK1. /evidence=ECO:0000250|UniProtKB:P21457 189..192
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.