DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and chpf-2

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_503830.2 Gene:chpf-2 / 186617 WormBaseID:WBGene00019108 Length:195 Species:Caenorhabditis elegans


Alignment Length:189 Identity:77/189 - (40%)
Similarity:114/189 - (60%) Gaps:23/189 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSLPM---EMC-----SNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQR 57
            |||..|..:   ||.     :.|:..:|.||..||..||.:..|.||.|:|:::|||..|||..|
 Worm     1 MGNSNSSILSDAEMREIMDETQFNKHQILRLYTRFASLDKNGQGYLSRDDFLNVPELAVNPLGDR 65

  Fly    58 VIDIF----DADG---NGEVDFKEFIQGVSQF----SVKGDKLS----KLRFAFRIYDMDNDGYI 107
            :||.|    |:||   :|::.|::|::.::.|    .||.:.|:    ||||||::||::.:.||
 Worm    66 IIDAFFTLGDSDGDSKSGQLTFRQFVRILAHFQPISKVKDNALNSRKDKLRFAFKMYDLNKNNYI 130

  Fly   108 SNGELFQVLKMMVGNNLKDTQLQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKM 166
            :..|...:|..|||.|:...||.:|.|||:..||:|.||||||::||..:..|||.:||
 Worm   131 TREEFKVILNSMVGANITSDQLDKIADKTLEEADQDRDGKISFEDFCRAMEKTDIEEKM 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 64/155 (41%)
chpf-2NP_503830.2 FRQ1 15..182 CDD:227455 66/166 (40%)
EFh 35..95 CDD:298682 24/59 (41%)
EFh 114..180 CDD:238008 33/65 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.830

Return to query results.
Submit another query.