DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and Ncs1

DIOPT Version :10

Sequence 1:NP_524874.2 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_062655.1 Gene:Ncs1 / 14299 MGIID:109166 Length:190 Species:Mus musculus


Alignment Length:151 Identity:50/151 - (33%)
Similarity:79/151 - (52%) Gaps:15/151 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FDADEIRRLGKRFRKLDLDNSGALSVDEFMSL-----PELQQNPLVQRVIDIFDADGNGEVDFKE 74
            |...|:::..|.|.| |.. ||.|....|..:     |..........|.::||.:.:|.::|.|
Mouse    22 FTEKEVQQWYKGFIK-DCP-SGQLDAAGFQKIYKQFFPFGDPTKFATFVFNVFDENKDGRIEFSE 84

  Fly    75 FIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQV---LKMMVGNNL----KDTQLQQI 132
            |||.:|..| :|....|||:||::||:||||||:..|:..:   :..||||.:    ::...::.
Mouse    85 FIQALSVTS-RGTLDEKLRWAFKLYDLDNDGYITRNEMLDIVDAIYQMVGNTVELPEEENTPEKR 148

  Fly   133 VDKTIGFADKDEDGKISFDEF 153
            ||:.....||:.|||::..||
Mouse   149 VDRIFAMMDKNADGKLTLQEF 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_524874.2 FRQ1 20..157 CDD:444056 48/146 (33%)
Ncs1NP_062655.1 FRQ1 22..174 CDD:444056 50/151 (33%)
Interaction with IL1RAPL1. /evidence=ECO:0000250|UniProtKB:P62166 174..190
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.