DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and guca1a

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_571945.1 Gene:guca1a / 140430 ZFINID:ZDB-GENE-011128-5 Length:189 Species:Danio rerio


Alignment Length:161 Identity:45/161 - (27%)
Similarity:82/161 - (50%) Gaps:14/161 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNETSLPMEMCSNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPEL-----QQNPLVQRVID 60
            |||.|...::   :..|.|:....|:|  :....||.|::.||.....|     :.|..::::..
Zfish     1 MGNSTGSTVD---DLQAVEMHLWYKKF--MTECPSGQLTLHEFKQFFGLRGLDPKANAYIEQMFR 60

  Fly    61 IFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLK 125
            .||.:.:|.:||.|::..:| ..::|....|||:.|::||:|.:|.|...||..::|.:...|..
Zfish    61 TFDMNKDGYIDFMEYVAALS-LVMRGKMEHKLRWYFKLYDVDGNGCIDRYELLNIIKAIRAINGS 124

  Fly   126 DTQ---LQQIVDKTIGFADKDEDGKISFDEF 153
            :||   .::..::.....|.:.||::|.|||
Zfish   125 ETQESSAEEFTNRVFERIDINGDGELSLDEF 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 41/149 (28%)
guca1aNP_571945.1 EFh <27..76 CDD:298682 13/48 (27%)
EFh 54..116 CDD:238008 19/62 (31%)
EF-hand_7 55..115 CDD:290234 19/60 (32%)
EFh 90..160 CDD:238008 22/66 (33%)
EF-hand_7 91..157 CDD:290234 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.