DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and CHP1

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:NP_009167.1 Gene:CHP1 / 11261 HGNCID:17433 Length:195 Species:Homo sapiens


Alignment Length:171 Identity:70/171 - (40%)
Similarity:98/171 - (57%) Gaps:15/171 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SNFDADEIRRLGKRFRKLDLDNSGALSVDEFMSLPELQQNPLVQRVIDIFDADGNGEVDFKEFIQ 77
            :.|...:|.||..||..||...:|.||.::|..:|||..|||..|:|:.|..:|..:|:|:.|::
Human    21 TGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFMR 85

  Fly    78 GVSQF----------SVKG-----DKLSKLRFAFRIYDMDNDGYISNGELFQVLKMMVGNNLKDT 127
            .::.|          .|.|     .:.:||.||||:||:|.|..||..||.|||:||||.|:.|.
Human    86 TLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFRLYDLDKDEKISRDELLQVLRMMVGVNISDE 150

  Fly   128 QLQQIVDKTIGFADKDEDGKISFDEFCSVVGNTDIHKKMVV 168
            ||..|.|:||..||:|.|..|||.||..|:...|:.:||.:
Human   151 QLGSIADRTIQEADQDGDSAISFTEFVKVLEKVDVEQKMSI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 65/155 (42%)
CHP1NP_009167.1 FRQ1 1..182 CDD:227455 67/160 (42%)
Necessary for association with microtubule and interaction with GAPDH. /evidence=ECO:0000250 2..6
Nuclear export signal 1. /evidence=ECO:0000250 138..147 6/8 (75%)
Necessary for nuclear export signal 143..185 20/41 (49%)
Nuclear export signal 2. /evidence=ECO:0000250 176..185 2/8 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0034
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53747
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 1 1.000 - - FOG0000640
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.