DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and LOC100536377

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_003201427.1 Gene:LOC100536377 / 100536377 -ID:- Length:188 Species:Danio rerio


Alignment Length:176 Identity:49/176 - (27%)
Similarity:90/176 - (51%) Gaps:18/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 GNETSLPMEMCSNFD------ADEIRRLGKRFRKLDLDNSG----ALSVDEFMSLPELQQNPLVQ 56
            |..:.||.|:.|.:.      ..||....|||.:|....:|    .:|:::.::||||:.||..:
Zfish     3 GTASKLPKELLSEYQELTFLTKQEILLAHKRFSELQGRENGPYSSRVSMEKILTLPELKSNPFRK 67

  Fly    57 RVIDIFDADG--NGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQVLKMM 119
            |:..:|....  :|.:.|::|:..:|.||.......|..:||||:|.|:||.:...:|.:::..:
Zfish    68 RICHVFSTSDLRDGSLTFEDFLDLLSAFSDSATLEIKSHYAFRIFDFDDDGTLDARDLEKLVNCL 132

  Fly   120 VGNNLKDTQL-----QQIVDKTIGFADKDEDGKISFDEFCSVVGNT 160
            .|.. .||:|     :|::...:..:|.|:||.::..||..|:..:
Zfish   133 TGET-DDTRLTAEEMRQLISNILEESDIDKDGTVNLSEFQHVISRS 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 43/157 (27%)
LOC100536377XP_003201427.1 FRQ1 4..179 CDD:227455 48/175 (27%)
EFh 108..175 CDD:238008 21/67 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.