DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CanB2 and cib3

DIOPT Version :9

Sequence 1:NP_001246192.1 Gene:CanB2 / 46456 FlyBaseID:FBgn0015614 Length:170 Species:Drosophila melanogaster
Sequence 2:XP_003198013.2 Gene:cib3 / 100535603 ZFINID:ZDB-GENE-121121-1 Length:218 Species:Danio rerio


Alignment Length:169 Identity:54/169 - (31%)
Similarity:86/169 - (50%) Gaps:16/169 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGNE----TSLPMEM---CSNFDADEIRRLGKRFR-------KLDLDNSG--ALSVDEFMSLPEL 49
            |||:    ||..::.   |:.|...||.||..|:|       .||..|..  .|..:...|:|||
Zfish    32 MGNKQTIFTSQQLDAYQDCTYFTRKEILRLFHRYRDLAPQLVPLDYTNEPDVRLPYELIGSMPEL 96

  Fly    50 QQNPLVQRVIDIFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGYISNGELFQ 114
            :.||..||:.::|..||.|.:...:|:...|..|....:..|..:||:|||.:||.:|...:|.:
Zfish    97 KDNPFRQRIAEVFSEDGQGNMTLDDFLDMFSVMSEMAPRDLKAYYAFKIYDFNNDDFICKSDLEK 161

  Fly   115 VLKMMVGNNLKDTQLQQIVDKTIGFADKDEDGKISFDEF 153
            .|..:..|.|.:.:::.:.:|.|..||.|.||::|.::|
Zfish   162 TLNKLTRNELTEDEVRMVCEKVIDEADLDNDGRLSLEDF 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CanB2NP_001246192.1 FRQ1 13..154 CDD:227455 48/150 (32%)
cib3XP_003198013.2 FRQ1 40..209 CDD:227455 51/161 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1271942at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.