DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and AT3G61010

DIOPT Version :10

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_191660.3 Gene:AT3G61010 / 825272 AraportID:AT3G61010 Length:427 Species:Arabidopsis thaliana


Alignment Length:49 Identity:21/49 - (42%)
Similarity:27/49 - (55%) Gaps:0/49 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEY 137
            |..|.|.||.|.|:.||..||.|...||.:.|..::.|||.:..|.:||
plant   369 IDVEYNVSYVYHALDAYIERDNVGLKGFTKFFNDSSLEERGYAEKFMEY 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 21/49 (43%)
AT3G61010NP_191660.3 Glyco_hydro_85 <3..39 CDD:461002
Ferritin_like 369..>418 CDD:469698 21/49 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.