DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and FER3

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_191168.1 Gene:FER3 / 824775 AraportID:AT3G56090 Length:259 Species:Arabidopsis thaliana


Alignment Length:207 Identity:60/207 - (28%)
Similarity:93/207 - (44%) Gaps:28/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 QLKEKQNLSHEGQDQECKGSLAVPEITKDWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRD 109
            ::|::.:|...||.......|..||           |...:..||..|.|.||.|.|:.|||.||
plant    70 EVKKEMDLVPSGQQLSLARHLYSPE-----------CEAAVNEQINVEYNVSYVYHALYAYFDRD 123

  Fly   110 TVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLINVPTVAKQ------EWTDGAAA 168
            .|...|.|:.|.:::.|||||...|:||.:.||    |...|  .|.|..|      |..|...|
plant   124 NVALKGLAKFFKESSVEEREHAELLMEYQNKRG----GRVKL--QPMVLPQSEFDHPEKGDALYA 182

  Fly   169 LSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTN 233
            :..||.||..|.:.:..|.......  :...|.|::..|:|.||:...::::..::.|:::...:
plant   183 MELALSLEKLVNEKLLNLHSVASKN--DDVQLADFIESVFLNEQVEAIKKISEYVSQLRRLGKGH 245

  Fly   234 GELGEFLFDKTL 245
               |.:.||:.|
plant   246 ---GTWHFDQEL 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 51/169 (30%)
Ferritin 82..229 CDD:278632 48/152 (32%)
FER3NP_191168.1 Euk_Ferritin 92..253 CDD:153114 54/182 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.