DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and LOC691895

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001103837.1 Gene:LOC691895 / 691895 RGDID:1594594 Length:176 Species:Rattus norvegicus


Alignment Length:171 Identity:46/171 - (26%)
Similarity:76/171 - (44%) Gaps:11/171 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 DWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEY 137
            ||     .|...:...||..:.|||.|::|..||.||.|....|...|...:.|.:......:..
  Rat    13 DW-----HCEDAVNTHIQLRLYASYVYMSMAVYFDRDDVALGNFKRFFLSKSHECQAKAEVFMHL 72

  Fly   138 LSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVD 202
            .:.||    |...|.::....:..|..|:.|:..||.:|:.:.:|:..:.:..:.|  ....|..
  Rat    73 QNTRG----GCLSLHDIARPERDSWHGGSQAMECALHMEMMINQSLLNMHEVAKEK--GDAQLCH 131

  Fly   203 YLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243
            :|...:|.:|:...:|:.|.||.|::|......|.|:||||
  Rat   132 FLEQNFLNQQVEVLKEVGGYLTNLRQMGAQEHSLAEYLFDK 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 42/163 (26%)
Ferritin 82..229 CDD:278632 36/146 (25%)
LOC691895NP_001103837.1 Euk_Ferritin 13..173 CDD:153114 46/171 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X152
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.