DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and Fthl17e

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_001060160.4 Gene:Fthl17e / 681066 RGDID:1584678 Length:182 Species:Rattus norvegicus


Alignment Length:179 Identity:45/179 - (25%)
Similarity:89/179 - (49%) Gaps:11/179 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 AVPEITKDWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREH 130
            :|.::.:.::...:|   .:.:|||.::..||.||:|.::.:::.|....||..|.:.:::....
  Rat     4 SVSQMEQTYLSESNA---ALNSQIQLQLYGSYIYLSMASFCNQEEVALGSFALFFLRQSQKWMGR 65

  Fly   131 GSKLVEYLSMR-GQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKP 194
            ...|...|:.| |.||.|     .:.:..:|:|.||..|:..|..||..:.:|:.:|.....:| 
  Rat    66 TEMLFSLLTERQGSLTLG-----RIASQDRQDWLDGLMAMECAFHLEKTLNQSLLQLYNLANSK- 124

  Fly   195 YNHYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243
             ...:|.::|...:|.:|:...:|:.|.:|.|::|........|.|||:
  Rat   125 -GDLYLCNFLKSHFLPQQVEILKEMGGYMTNLRRMGAPENRNAEKLFDQ 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 43/164 (26%)
Ferritin 82..229 CDD:278632 38/147 (26%)
Fthl17eXP_001060160.4 Euk_Ferritin 15..173 CDD:153114 44/168 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.