DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and LOC680520

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_001057542.2 Gene:LOC680520 / 680520 RGDID:1590640 Length:170 Species:Rattus norvegicus


Alignment Length:142 Identity:31/142 - (21%)
Similarity:59/142 - (41%) Gaps:18/142 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLT 145
            |...:...:...::.|:.|||| ||..|:....|.|.|:|...|...||.....:::|..|    
  Rat    11 CTDALNRVVAYHLHTSHVYLAM-AYSFRNDKRIPPFVEYFETLANTRREDADAFLKHLWKR---- 70

  Fly   146 EGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGV--- 207
               :..|..||:.|.:..:....: :|:.|..::.:::..::...:........|:..||.|   
  Rat    71 ---NTAICPPTLEKVDMMEITTPI-EAILLAQEMERTLTSILVGLQGAARRESDLLRLLTSVLRK 131

  Fly   208 ------YLEEQL 213
                  |::.||
  Rat   132 QRKNEDYMKTQL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 31/142 (22%)
Ferritin 82..229 CDD:278632 30/141 (21%)
LOC680520XP_001057542.2 Euk_Ferritin 8..153 CDD:153114 31/142 (22%)
Ferritin 13..143 CDD:278632 28/138 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.