DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and fth1a

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_571660.1 Gene:fth1a / 58108 ZFINID:ZDB-GENE-000831-2 Length:177 Species:Danio rerio


Alignment Length:168 Identity:59/168 - (35%)
Similarity:88/168 - (52%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSM 140
            :.::||...:..||..|:.|||.||:|..||.||......||:.|...:.|||||..||:::.:.
Zfish     8 NFEEACEAAVNRQINMELYASYVYLSMSYYFDRDDQALHNFAKFFRHQSHEEREHAEKLMKFQNQ 72

  Fly   141 RGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLT 205
            ||    |...|.:|....|.||..|..||..||.||..|..|:.:|.:....  :|..|:.|::.
Zfish    73 RG----GRIFLQDVKKPEKDEWGSGVEALECALQLEKSVNHSLLELHKLASQ--HNDPHMCDFIE 131

  Fly   206 GVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243
            ..||:||:...:||...:|.|::|......:.|::|||
Zfish   132 THYLDEQVKSIKELGDHVTNLRRMGAPQNGMAEYMFDK 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 57/163 (35%)
Ferritin 82..229 CDD:278632 52/146 (36%)
fth1aNP_571660.1 Euk_Ferritin 11..170 CDD:153114 59/165 (36%)
Ferritin 14..155 CDD:278632 52/146 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.