DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and zgc:172145

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001119864.1 Gene:zgc:172145 / 559095 ZFINID:ZDB-GENE-080516-9 Length:202 Species:Danio rerio


Alignment Length:248 Identity:52/248 - (20%)
Similarity:92/248 - (37%) Gaps:65/248 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VKLIASLLLLAVVAQAYGDFKCALSKQESKSFVRELQREREEHQLKEKQNLSHEGQDQECKGSLA 66
            ||.|.:.|||.         |..:|..||                :.|||.....::..|..|..
Zfish     6 VKRIKTCLLLC---------KTHVSSAES----------------QVKQNFPRVVEESLCGVSTL 45

  Fly    67 VPEITKDWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHG 131
            :.|:                         ||:..|:|..|.:..:..|..|.:|.:.:.:|:|..
Zfish    46 LLEV-------------------------SYKLEALGRIFEQSNLALPRVAAYFHQESVKEQERA 85

  Fly   132 SKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYN 196
            ..:::|||.||    |.....|:    ::..|:...|:..||::.:...|....::....:..:.
Zfish    86 EVMLQYLSQRG----GKYCNKNI----QRPGTEQVCAVLPALEIMLNQWKEEMSVMLEINHLAHE 142

  Fly   197 H--YHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMM----DTNGELGEFLFDK 243
            |  .|....:...:: |.|..:.:|.|.|.|..:.:    |:....||||.|:
Zfish   143 HDDPHTASVIKSQFI-EPLVQKVKLVGDLLTNARRVGCTDDSAAGFGEFLIDQ 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 35/169 (21%)
Ferritin 82..229 CDD:278632 30/148 (20%)
zgc:172145NP_001119864.1 Ferritin_like 35..195 CDD:294190 39/194 (20%)
Ferritin 44..177 CDD:278632 31/166 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
65.880

Return to query results.
Submit another query.