DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and LOC558816

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_687175.1 Gene:LOC558816 / 558816 -ID:- Length:175 Species:Danio rerio


Alignment Length:165 Identity:59/165 - (35%)
Similarity:85/165 - (51%) Gaps:10/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLT 145
            |...:...|..|:.|.|.|.:|..||.||.|..||||:.|.|.::|||||..|.:|:.:.||   
Zfish    14 CEAAINKMINLELYAGYTYTSMAHYFKRDDVALPGFAKFFNKNSEEEREHAEKFMEFQNKRG--- 75

  Fly   146 EGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKL--IQTCENKPYNHYHLVDYLTGVY 208
             |...|.::....:..|.:|..|:..||.||..|.:::..|  :.|....|    ||.|:|...|
Zfish    76 -GRIVLQDIKKPDRDVWGNGLIAMQCALQLEKNVNQALLDLHKLATEMGDP----HLCDFLESHY 135

  Fly   209 LEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243
            |:||:...::|...:|.|.||...|..:.|:||||
Zfish   136 LDEQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 57/163 (35%)
Ferritin 82..229 CDD:278632 50/148 (34%)
LOC558816XP_687175.1 Euk_Ferritin 11..170 CDD:153114 57/163 (35%)
Ferritin 15..156 CDD:278632 50/148 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.