DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and FTHL17

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_114100.1 Gene:FTHL17 / 53940 HGNCID:3987 Length:183 Species:Homo sapiens


Alignment Length:163 Identity:52/163 - (31%)
Similarity:78/163 - (47%) Gaps:6/163 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLT 145
            |...:.:.|..|:..||.||:|..||:||.|....|..:|.:.:.::.||..||:...::||   
Human    17 CDAAINSHITLELYTSYLYLSMAFYFNRDDVALENFFRYFLRLSDDKMEHAQKLMRLQNLRG--- 78

  Fly   146 EGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLE 210
             |...|.::.....|.|..|..|:..|..||..|.:|:..|.|....|  ....|..:|...||.
Human    79 -GHICLHDIRKPECQGWESGLVAMESAFHLEKNVNQSLLDLYQLAVEK--GDPQLCHFLESHYLH 140

  Fly   211 EQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243
            ||:...:||.|.::.|:|:......|.|:||||
Human   141 EQVKTIKELGGYVSNLRKICSPEAGLAEYLFDK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 50/161 (31%)
Ferritin 82..229 CDD:278632 44/146 (30%)
FTHL17NP_114100.1 Euk_Ferritin 14..174 CDD:153114 52/163 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.