DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and Fer2LCH

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001263106.1 Gene:Fer2LCH / 44965 FlyBaseID:FBgn0015221 Length:236 Species:Drosophila melanogaster


Alignment Length:180 Identity:46/180 - (25%)
Similarity:78/180 - (43%) Gaps:18/180 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ACIKGMRNQIQEEINA----SYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSM 140
            |.|..:..:||..|||    ||.||.:..:|:....|||||.:.:...:....|....|::.::.
  Fly    58 AGIDHIEPEIQSYINANLAKSYDYLLLATHFNSYQKNRPGFQKLYQGLSDRSFEDSIALIKQVTR 122

  Fly   141 RGQLTEGVSDLINVPTVAKQEWT---DGAAALSDALDLEIKVTKSIRKL------IQTCENKPYN 196
            ||.:.:..:...:..:|:.:..|   |...:|:.|||.|.::......:      ....|..|  
  Fly   123 RGGIVDFNTRHESSGSVSTKRGTLEVDELHSLALALDTEKQLATGATHVHSRATHATDAERDP-- 185

  Fly   197 HYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDT-NGELGEFLFDKTL 245
              .|..|....:|.:|....|:|:|....|.|:|.. :..|..:|||:.|
  Fly   186 --ELAHYFEENFLGKQAESVRKLSGYANDLAKLMKVPDPSLSVYLFDEYL 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 44/176 (25%)
Ferritin 82..229 CDD:278632 38/159 (24%)
Fer2LCHNP_001263106.1 Euk_Ferritin 60..232 CDD:153114 44/175 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.