DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and zgc:56095

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_998178.1 Gene:zgc:56095 / 406286 ZFINID:ZDB-GENE-040426-1948 Length:179 Species:Danio rerio


Alignment Length:160 Identity:49/160 - (30%)
Similarity:85/160 - (53%) Gaps:14/160 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLIN 153
            |..::.|||.||::|.||.||.|..|.|.:.|.:.:.:||:|...|:||.:.||       ..|.
Zfish    20 INLKLTASYVYLSLGMYFDRDDVALPNFPKFFLERSHKERDHAEDLLEYQNTRG-------GRIL 77

  Fly   154 VPTVAK---QEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLHG 215
            :.||||   .:|..|..||:.:|:.:..:.:|:.::.:....  ::..||.|:|.|.:..:....
Zfish    78 LQTVAKPSRDDWKGGIDALAFSLEHQKSINRSLLEVHRVAGE--HSDPHLSDFLEGKFFTDSHET 140

  Fly   216 QRELAGKLTTLKKM--MDTNGELGEFLFDK 243
            .:.|...|.:|.::  .|.:|::.|:||||
Zfish   141 IKTLGDYLGSLSRITSSDPHGKMAEYLFDK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 47/158 (30%)
Ferritin 82..229 CDD:278632 42/142 (30%)
zgc:56095NP_998178.1 Euk_Ferritin 9..171 CDD:153114 49/160 (31%)
Ferritin 13..154 CDD:278632 42/142 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.