DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and MGC75752

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_989212.1 Gene:MGC75752 / 394820 -ID:- Length:178 Species:Xenopus tropicalis


Alignment Length:180 Identity:55/180 - (30%)
Similarity:97/180 - (53%) Gaps:13/180 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 AVPEITKDWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREH 130
            |..:|.:::.:..:|.|..:.|.   |:..||.||::|.||.||.|....|::::.:.::::|:|
 Frog     3 AQSQIRQNYHEESEAGINRIANL---ELQTSYVYLSLGYYFDRDDVALSKFSKYYRELSEKKRDH 64

  Fly   131 GSKLVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKL--IQTCENK 193
            ...|:::.:.||    |...|.::......||.:|..|:..||:||..|.:::..|  |.|....
 Frog    65 AEDLLKFQNKRG----GRVVLQDIKKPDADEWGNGTKAMEVALNLEKSVNQALLDLHKIATDHAD 125

  Fly   194 PYNHYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243
            |    |:.|||...:|||::...::|...||.||::......:||:||||
 Frog   126 P----HMCDYLEREFLEEEVKIIKKLGDHLTNLKRVKAAEDGMGEYLFDK 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 51/165 (31%)
Ferritin 82..229 CDD:278632 46/148 (31%)
MGC75752NP_989212.1 Euk_Ferritin 12..172 CDD:153114 53/171 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.