DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and Fer3HCH

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_572854.1 Gene:Fer3HCH / 32260 FlyBaseID:FBgn0030449 Length:186 Species:Drosophila melanogaster


Alignment Length:166 Identity:59/166 - (35%)
Similarity:93/166 - (56%) Gaps:14/166 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 ACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQL 144
            :|.|.:.:||..|:.||:|||||..:|.|..::.||....|.||:.|||||..|::.|::.||  
  Fly    23 SCEKKLNDQINMELKASHQYLAMAYHFDRSDISSPGMHRFFLKASVEEREHAEKIMTYMNKRG-- 85

  Fly   145 TEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKL--IQTCENKPYNHYHLVDYLTGV 207
              |:..|.:||..... :.....||..|:.:|::|.|.:..|  :...|..|    :|.|::...
  Fly    86 --GLIILSSVPQPLPC-FASTLDALKHAMKMELEVNKHLLDLHALAGKEADP----NLCDFIEAN 143

  Fly   208 YLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243
            :|:||:.||:.||..::.|:|   ...::|||||||
  Fly   144 FLQEQVDGQKILADYISQLEK---AQNQVGEFLFDK 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 57/164 (35%)
Ferritin 82..229 CDD:278632 50/148 (34%)
Fer3HCHNP_572854.1 Euk_Ferritin 24..177 CDD:153114 59/165 (36%)
Ferritin 25..165 CDD:278632 51/151 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 45 1.000 Domainoid score I723
eggNOG 1 0.900 - - E1_COG1528
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 47 1.000 Inparanoid score I474
Isobase 1 0.950 - 0 Normalized mean entropy S2879
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
98.920

Return to query results.
Submit another query.