DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and RGD1561106

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_038956363.1 Gene:RGD1561106 / 302548 RGDID:1561106 Length:216 Species:Rattus norvegicus


Alignment Length:166 Identity:39/166 - (23%)
Similarity:76/166 - (45%) Gaps:12/166 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLT 145
            |...:...::.:::.||.||:|..||.|:.|....|:.:|...:.|...:....:...:.||   
  Rat    50 CEAAINRHVRLQLSTSYVYLSMCFYFDREDVALENFSRYFLNKSHECTRNAEIFLALQNQRG--- 111

  Fly   146 EGVSDLINVPTVAKQE---WTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGV 207
                ..|::.|:.|.:   |..|..|:..|..||:.:.:|:..:.|....|  ...||..:|...
  Rat   112 ----GRISLRTIYKPDCDNWIGGLPAMERAFQLELHLNQSLVAMYQLAARK--RDGHLCSFLQTH 170

  Fly   208 YLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243
            :|.:|:...:|::..|.::::|......:.|:||.|
  Rat   171 FLRKQVAVLKEMSSFLISMRQMGSPEVGMAEYLFGK 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 38/164 (23%)
Ferritin 82..229 CDD:278632 33/149 (22%)
RGD1561106XP_038956363.1 Euk_Ferritin 47..207 CDD:153114 39/166 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.