DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and RGD1561661

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001100424.1 Gene:RGD1561661 / 302536 RGDID:1561661 Length:173 Species:Rattus norvegicus


Alignment Length:157 Identity:35/157 - (22%)
Similarity:70/157 - (44%) Gaps:12/157 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLIN 153
            |...:.||.:||::|..| :|..:..|.. |||:...||:...:    ||.:............|
  Rat    21 ISMHLEASDRYLSLGFVF-KDDCSVAGLV-HFFRDLSEEKRQAA----YLLLMQTRQSDCGHFSN 79

  Fly   154 VPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCE--NKPYNHYHLVDYLTGVYLEEQLHGQ 216
            .|||...: .||:.   ||::..:.:.|::.:::....  ......:.|..:|...:||::::..
  Rat    80 GPTVPSYQ-CDGSL---DAMETTLALEKNLNQVLLDLHALGSSNADFQLCHFLEKHFLEKEMNLI 140

  Fly   217 RELAGKLTTLKKMMDTNGELGEFLFDK 243
            ::::..||.|::.......|.|.|..:
  Rat   141 KKISDYLTNLRQQASEEESLSECLLKR 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 35/155 (23%)
Ferritin 82..229 CDD:278632 32/141 (23%)
RGD1561661NP_001100424.1 Euk_Ferritin 12..162 CDD:153114 33/150 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.