DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and FTH1

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_002023.2 Gene:FTH1 / 2495 HGNCID:3976 Length:183 Species:Homo sapiens


Alignment Length:161 Identity:60/161 - (37%)
Similarity:85/161 - (52%) Gaps:10/161 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 MRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVS 149
            :..||..|:.|||.||:|..||.||.|....||::|...:.|||||..||::..:.||    |..
Human    21 INRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG----GRI 81

  Fly   150 DLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKL--IQTCENKPYNHYHLVDYLTGVYLEEQ 212
            .|.::......:|..|..|:..||.||..|.:|:.:|  :.|.:|.|    ||.|::...||.||
Human    82 FLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDP----HLCDFIETHYLNEQ 142

  Fly   213 LHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243
            :...:||...:|.|:||......|.|:||||
Human   143 VKAIKELGDHVTNLRKMGAPESGLAEYLFDK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 58/159 (36%)
Ferritin 82..229 CDD:278632 52/145 (36%)
FTH1NP_002023.2 Euk_Ferritin 14..174 CDD:153114 60/161 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.