DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and Ftdc2

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_778176.1 Gene:Ftdc2 / 224247 MGIID:3045360 Length:192 Species:Mus musculus


Alignment Length:156 Identity:38/156 - (24%)
Similarity:63/156 - (40%) Gaps:26/156 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 DACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQ 143
            :.|.|.:...:...::.|:.|.||...|.........|.:||...|...||:.::.:.:|..|.:
Mouse     9 EECTKALNQVVAYHLHTSHVYFAMAHSFMTGKKETFPFVQHFETLADSRREYANRFLNHLWTRNK 73

  Fly   144 LTEGVSDLINVPTVAK---QEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLT 205
                  .:...||..|   :|.|...:||..|.::|..:||.:..|......:.    .|:.:||
Mouse    74 ------KICPPPTYEKVDMKEITTPKSALLMAQNMEETLTKILLALKAAARRES----DLLKFLT 128

  Fly   206 GV---------YLEEQL----HGQRE 218
            .|         |||.||    .|:|:
Mouse   129 SVLCKQREFKEYLESQLSPPQKGKRK 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 38/156 (24%)
Ferritin 82..229 CDD:278632 37/153 (24%)
Ftdc2NP_778176.1 Euk_Ferritin 8..177 CDD:153114 38/156 (24%)
Ferritin 13..145 CDD:278632 33/141 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.870

Return to query results.
Submit another query.