DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and ftn-1

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_504944.2 Gene:ftn-1 / 179138 WormBaseID:WBGene00001500 Length:170 Species:Caenorhabditis elegans


Alignment Length:159 Identity:56/159 - (35%)
Similarity:80/159 - (50%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 MRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVS 149
            :..||..|:.|||.||:|.|:|.||.:.....|:.|.:.:.|||.|.::|:...::||    |..
 Worm    16 VNKQINVELYASYVYLSMSAHFDRDDIALRNIAKFFKEQSDEERGHATELMRIQAVRG----GRV 76

  Fly   150 DLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLH 214
            .:.|:....|.||.....|...||.||.....|:.||....|.:  |..||.:|:...|||||:|
 Worm    77 AMQNIQKPEKDEWGTVLEAFEAALALERANNASLLKLHGIAEQR--NDAHLTNYIQEKYLEEQVH 139

  Fly   215 GQRELAGKLTTLKKMMDTNGELGEFLFDK 243
            ...|.|..:..:|:   ....|||:||||
 Worm   140 SINEFARYIANIKR---AGPGLGEYLFDK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 54/157 (34%)
Ferritin 82..229 CDD:278632 49/143 (34%)
ftn-1NP_504944.2 Euk_Ferritin 9..166 CDD:153114 56/159 (35%)
Ferritin 13..154 CDD:278632 49/146 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.880

Return to query results.
Submit another query.