DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and ftn-2

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_491198.1 Gene:ftn-2 / 171934 WormBaseID:WBGene00001501 Length:170 Species:Caenorhabditis elegans


Alignment Length:159 Identity:56/159 - (35%)
Similarity:82/159 - (51%) Gaps:9/159 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 MRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVS 149
            :..||..|:.|||.||:|..||.||.|..|..|:.|.:.:.|||||.::|:...::||    |..
 Worm    16 VNKQINIELYASYVYLSMSFYFDRDDVALPNIAKFFKEQSDEEREHATELMRVQNLRG----GRV 76

  Fly   150 DLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQLH 214
            .|.::......||.....|...||.||....:|:.||..|..|  :|..||.|::...||:||:.
 Worm    77 VLQDIQKPENDEWGTALKAFEAALALEKFNNESLLKLHSTAGN--HNDAHLTDFIEEKYLDEQVK 139

  Fly   215 GQRELAGKLTTLKKMMDTNGELGEFLFDK 243
            ...|.|..:..||::   ...:||::|||
 Worm   140 SINEFARMVANLKRV---GPGVGEYVFDK 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 54/157 (34%)
Ferritin 82..229 CDD:278632 51/143 (36%)
ftn-2NP_491198.1 Euk_Ferritin 9..166 CDD:153114 56/159 (35%)
Ferritin 13..154 CDD:278632 51/143 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2879
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.830

Return to query results.
Submit another query.