DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and Fth1

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_034369.1 Gene:Fth1 / 14319 MGIID:95588 Length:182 Species:Mus musculus


Alignment Length:161 Identity:59/161 - (36%)
Similarity:86/161 - (53%) Gaps:10/161 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 MRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVS 149
            :..||..|:.|||.||:|..||.||.|....||::|...:.|||||..||::..:.||    |..
Mouse    21 INRQINLELYASYVYLSMSCYFDRDDVALKNFAKYFLHQSHEEREHAEKLMKLQNQRG----GRI 81

  Fly   150 DLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKL--IQTCENKPYNHYHLVDYLTGVYLEEQ 212
            .|.::....:.:|..|..|:..||.||..|.:|:.:|  :.|.:|.|    ||.|::...||.||
Mouse    82 FLQDIKKPDRDDWESGLNAMECALHLEKSVNQSLLELHKLATDKNDP----HLCDFIETYYLSEQ 142

  Fly   213 LHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243
            :...:||...:|.|:||......:.|:||||
Mouse   143 VKSIKELGDHVTNLRKMGAPEAGMAEYLFDK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 57/159 (36%)
Ferritin 82..229 CDD:278632 52/145 (36%)
Fth1NP_034369.1 Euk_Ferritin 14..174 CDD:153114 59/161 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2879
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.