DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and LOC108352322

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_038944683.1 Gene:LOC108352322 / 108352322 RGDID:11424835 Length:182 Species:Rattus norvegicus


Alignment Length:146 Identity:29/146 - (19%)
Similarity:62/146 - (42%) Gaps:23/146 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 IQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLTEGVSDLIN 153
            ||..::.:|.||   .|...|.....||..:....:.....:...:::|::.||       :.:.
  Rat    23 IQMNLSDAYLYL---TYLYSDDSTATGFGAYVQDKSLTSWFYAQSVLKYITGRG-------NKVC 77

  Fly   154 VPTVAKQEW-TDG-----AAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLEEQ 212
            :|.:.:.|. |.|     .|||:...:|::.:.:.:...:...:|:..||       :..::.:|
  Rat    78 IPDIQRPEIDTQGRIQCAMAALNMEKELKVILHRLLDLALNIKDNQTLNH-------SKDWIFKQ 135

  Fly   213 LHGQRELAGKLTTLKK 228
            ...:..||.::..|||
  Rat   136 QRNEERLAREIDELKK 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 29/146 (20%)
Ferritin 82..229 CDD:278632 29/146 (20%)
LOC108352322XP_038944683.1 Euk_Ferritin 10..157 CDD:153114 29/146 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.