DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and LOC100360087

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:XP_002729599.1 Gene:LOC100360087 / 100360087 RGDID:2322860 Length:183 Species:Rattus norvegicus


Alignment Length:185 Identity:46/185 - (24%)
Similarity:90/185 - (48%) Gaps:21/185 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EITKDWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSK 133
            :|.:::....:|.:..:.|.   .:.|||.||::|.:|.||.|...|....|.:.|:|:||...:
  Rat     4 QIRQNYSTEVEAAVNRLVNL---HLRASYTYLSLGFFFDRDDVALEGVGHFFRELAEEKREGAER 65

  Fly   134 LVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKL--IQTCENKPYN 196
            |::..:.||    |.:...:|...::.||.....|:..||.||..:.:::..|  :.:....|  
  Rat    66 LLKLQNERG----GRALFQDVQKPSQDEWGKTLEAMEAALALEKNLNQALLDLHALGSARTDP-- 124

  Fly   197 HYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMD--------TNGELGEFLFDK 243
              ||.|:|...:|::::...:::...||.|:::..        ....|||:||::
  Rat   125 --HLCDFLESHFLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGVAQASLGEYLFER 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 45/173 (26%)
Ferritin 82..229 CDD:278632 39/148 (26%)
LOC100360087XP_002729599.1 Ferritin 10..177 CDD:153098 45/177 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.