DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and fthl29

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001124139.1 Gene:fthl29 / 100170833 ZFINID:ZDB-GENE-080722-16 Length:175 Species:Danio rerio


Alignment Length:163 Identity:57/163 - (34%)
Similarity:81/163 - (49%) Gaps:6/163 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLT 145
            |...:...|..|:.|.|.|.:|..||.||.|..||||:.|...::|||||..|.:|:.:.||   
Zfish    14 CEALINKMINLELYAGYTYTSMAHYFKRDDVALPGFAKFFKNNSEEEREHAEKFMEFQNKRG--- 75

  Fly   146 EGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLE 210
             |...|.::....:..|.:|..|:..||.||..|.:::..|.:....|  ...||.|.|...||.
Zfish    76 -GRIVLQDIKKPGRDVWDNGLTAMQCALQLEKSVNQALLDLHKVASQK--GDPHLCDLLESHYLN 137

  Fly   211 EQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243
            ||:...::|...:|.|.||...|..:.|:||||
Zfish   138 EQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 55/161 (34%)
Ferritin 82..229 CDD:278632 48/146 (33%)
fthl29NP_001124139.1 Euk_Ferritin 11..171 CDD:153114 57/163 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.