DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and zgc:173594

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001103324.1 Gene:zgc:173594 / 100126128 ZFINID:ZDB-GENE-071004-86 Length:175 Species:Danio rerio


Alignment Length:177 Identity:62/177 - (35%)
Similarity:92/177 - (51%) Gaps:13/177 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 EITKDWVDMKDACIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSK 133
            :|.:::....:|.|..|   |..|:.|.|.|.:|..||.||.|..||||:.|.|.::|||||..|
Zfish     5 QIRQNYARDSEAAINKM---INLELYAGYTYTSMAHYFKRDDVALPGFAKFFKKNSEEEREHAEK 66

  Fly   134 LVEYLSMRGQLTEGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKL--IQTCENKPYN 196
            .:|:.:.||    |...|.::....:..|.:|..|:..||.||..|.:::..|  :.|....|  
Zfish    67 FMEFQNKRG----GRIVLQDIKKPDRDVWGNGLIAMQCALQLEKNVNQALLDLHKLATEMGDP-- 125

  Fly   197 HYHLVDYLTGVYLEEQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243
              ||.|:|...||:||:...::|...:|.|.||...|..:.|:||||
Zfish   126 --HLCDFLETHYLDEQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 59/165 (36%)
Ferritin 82..229 CDD:278632 52/148 (35%)
zgc:173594NP_001103324.1 Euk_Ferritin 13..171 CDD:153114 61/169 (36%)
Ferritin 15..156 CDD:278632 53/151 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.