DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fer1HCH and fthl28

DIOPT Version :9

Sequence 1:NP_001263104.1 Gene:Fer1HCH / 46415 FlyBaseID:FBgn0015222 Length:245 Species:Drosophila melanogaster
Sequence 2:NP_001107131.1 Gene:fthl28 / 100006523 ZFINID:ZDB-GENE-030131-7540 Length:175 Species:Danio rerio


Alignment Length:163 Identity:57/163 - (34%)
Similarity:83/163 - (50%) Gaps:6/163 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 CIKGMRNQIQEEINASYQYLAMGAYFSRDTVNRPGFAEHFFKAAKEEREHGSKLVEYLSMRGQLT 145
            |...:...|..|:.|.|.|.:|..||.||.|...|||:.|.|.::|||||..|.:|:.:.||   
Zfish    14 CEASINKMISLELYAGYTYTSMAHYFKRDDVALNGFAKFFKKNSEEEREHAEKFMEFQNKRG--- 75

  Fly   146 EGVSDLINVPTVAKQEWTDGAAALSDALDLEIKVTKSIRKLIQTCENKPYNHYHLVDYLTGVYLE 210
             |...|.::....:..|.:|..|:..||.||..|.:::..|.:....|  ...||.|:|...||:
Zfish    76 -GRIVLQDIKKPDRDVWDNGLTAMQCALQLEKNVNQALLDLHKVASQK--GDPHLCDFLETHYLD 137

  Fly   211 EQLHGQRELAGKLTTLKKMMDTNGELGEFLFDK 243
            ||:...::|...:|.|.||...|..:.|:||||
Zfish   138 EQVEAIKKLGDHITNLSKMDAGNNRMAEYLFDK 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fer1HCHNP_001263104.1 Euk_Ferritin 79..243 CDD:153114 55/161 (34%)
Ferritin 82..229 CDD:278632 48/146 (33%)
fthl28NP_001107131.1 Euk_Ferritin 11..171 CDD:153114 57/163 (35%)
Ferritin 15..156 CDD:278632 48/146 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1528
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1249457at2759
OrthoFinder 1 1.000 - - FOG0000169
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11431
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X152
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.