DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYLK and cmk1

DIOPT Version :9

Sequence 1:XP_024309300.1 Gene:MYLK / 4638 HGNCID:7590 Length:1924 Species:Homo sapiens
Sequence 2:NP_593464.1 Gene:cmk1 / 2542442 PomBaseID:SPACUNK12.02c Length:335 Species:Schizosaccharomyces pombe


Alignment Length:308 Identity:104/308 - (33%)
Similarity:165/308 - (53%) Gaps:9/308 - (2%)


- Green bases have known domain annotations that are detailed below.


Human  1463 TINTEQKVSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFF-KAYSAKEKENIRQEISIMN-- 1524
            |::.:|.:...|.:...||.|.:..|...|..:|.|::|.|.. |....|:::.::.||:|:.  
pombe    20 TVDQKQLLPCKYRVGRVLGGGTYATVREAVHIETNKMYAAKIMNKKMMEKKQDFVKNEIAILKRV 84

Human  1525 CLHHPKLVQCVDAFEEKANIVMVLEIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQ 1589
            ...||.::..||.||...|:.::.|:.:|||||:||..:. ...|.:....||..:..|:|:|..
pombe    85 SYEHPNILHLVDFFETVNNLYLITELATGGELFDRICAKG-SFYEADAAALMRTTTSAVKYLHDN 148

Human  1590 GIVHLDLKPENIMCVNK-TGTRIKLIDFGLARRLENAG--SLKVLFGTPEFVAPEVINYEPIGYA 1651
            ||||.||||||::..:| ..:.:.:.||||:...|::.  .|....||||::||||......|..
pombe   149 GIVHRDLKPENLLYRSKDPNSDLLIADFGLSHFYEDSQYYMLMTACGTPEYMAPEVFRRTGYGKP 213

Human  1652 TDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKN 1716
            .|||:||||.|.|:||.:||...:..|.:..:.:..:.|:|..:..||:.|||||...|:.|...
pombe   214 VDMWAIGVITYFLLSGYTPFARPSQVEVIEAILANEYTFNDPCWSGISETAKDFIKKCLENDPSK 278

Human  1717 RLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRA 1764
            ||.....|:||:|.:  |......|..:..:.:.||:.::...|||||
pombe   279 RLTAADALKHPFLSE--KRPATSNLLPNVRENFNARKTFRTAYNAVRA 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYLKXP_024309300.1 I-set 43..133 CDD:254352
I-set 171..260 CDD:254352
23ISL 261..422 CDD:318761
I-set 424..514 CDD:254352
I-set 524..610 CDD:254352
I-set 633..722 CDD:254352
I-set 731..819 CDD:254352
I-set 1108..1197 CDD:254352
Ig8_hMLCK_like 1248..1345 CDD:143239
FN3 1341..1433 CDD:238020
STKc_MLCK1 1471..1729 CDD:271093 92/263 (35%)
I-set 1819..1909 CDD:254352
cmk1NP_593464.1 STKc_CAMK 30..290 CDD:270687 91/260 (35%)
S_TKc 31..291 CDD:214567 92/260 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.