DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYLK and unc-89

DIOPT Version :10

Sequence 1:XP_024309300.1 Gene:MYLK / 4638 HGNCID:7590 Length:1924 Species:Homo sapiens
Sequence 2:NP_001020985.1 Gene:unc-89 / 171990 WormBaseID:WBGene00006820 Length:8081 Species:Caenorhabditis elegans


Alignment Length:2286 Identity:490/2286 - (21%)
Similarity:804/2286 - (35%) Gaps:693/2286 - (30%)


- Green bases have known domain annotations that are detailed below.


Human    12 GDVKLVASSHISKTSLSVDPSRVDSMPLTEAPAFILPPRNLCIKEGATAKFEGRVRGYPEPQVTW 76
            |:|...:..|: |::.|.:|        |....|:.|.::..::||.....:..:.|.|.|:|.|
 Worm  5049 GEVYSGSVVHV-KSAKSSEP--------TSGANFLSPLKDTEVEEGDMLTLQCTIAGEPFPEVIW 5104

Human    77 HRNGQPITSGGRFLLDCGIRGTFSLVIHAVHEEDRGKYTCEATNGSGARQVTVELTVEGSFAKQL 141
            .::|..:....|..:...:.||.:|.|.:..:.|.|:|...|.|.:|:.....::||    .:|.
 Worm  5105 EKDGVVLQKDDRITMRVALDGTATLRIRSAKKSDIGQYRVTAKNEAGSATSDCKVTV----TEQG 5165

Human   142 GQPVVSKTLGDRFSAPAVETRPSIWGECPPKFATKLGRVVVKEGQMGRFSCKITGRPQPQVTWLK 206
            .||  ||                      |||...|.......|....|:.|:.|.|:|.:.|..
 Worm  5166 EQP--SK----------------------PKFVIPLKTGAALPGDKKEFNVKVRGLPKPTLQWFL 5206

Human   207 GNVPLQPSARVSVSE-KNGMQVLEIHGVNQDDVGVYTCLVVNGSGKASMSAELSIQGL--DSANR 268
            ..:|::...|:::.: .:|...|.|..|.::|.|...|:..|.:|......|.. ||.  |..:|
 Worm  5207 NGIPIKFDDRITLDDMADGNYCLTIRDVREEDFGTLKCIAKNENGTDETVCEFQ-QGAGHDDGSR 5270

Human   269 SFVRETKATNS---DVRKEVTNVISKESKLDSLEAAAKSKNCSSPQRGGSPPWAANSQPQPPRES 330
            ..:|.....|.   |.|..|.:.:..|..:|:...|                             
 Worm  5271 DDLRYPPRFNVPLWDRRIPVGDPMFIECHVDANPTA----------------------------- 5306

Human   331 KLESCKDSPR---TAPQTPVLQKTSSSITLQAARVQPEP-RAPGLGV-----LSPSGEERKRPAP 386
            ::|..||..:   || .|.:......     |.|::..| ....:||     ::..|:...:   
 Worm  5307 EVEWFKDGKKIEHTA-HTEIRNTVDG-----ACRIKIIPFEESDIGVYMCVAVNELGQAETQ--- 5362

Human   387 PRPATFPTRQPGLGSQDVVSKAANRRIPMEGQRDSAFPKFESKPQSQEVKENQTVKFRCEVSGIP 451
               ||:..        :::     ..:..|.:|:.| ||.....:.:.|...|.::..|:|..||
 Worm  5363 ---ATYQV--------EIL-----EHVEEEKRREYA-PKINPPLEDKTVNGGQPIRLSCKVDAIP 5410

Human   452 KPEVAWFLEGTPVRRQEGSIEVYEDAGSHYLCLLKARTRDSGTYSCTASNAQGQL--SCSWTLQV 514
            :..|.|:.:|.|:|....:...||:.|:..|.:..:...|.|.|.|.|:||.|.:  |||..::|
 Worm  5411 RASVVWYKDGLPLRADSRTSIQYEEDGTATLAINDSTEEDIGAYRCVATNAHGTINTSCSVNVKV 5475

Human   515 ERLAVMEVA--PSFSSVLKDCAVIEGQDFVLQCSVRGTPVPRITWLLNGQPIQYA-RSTCEA--- 573
            .:..|.:..  |.|:..|.|.....|..|.|:|:|.|.|.|.|.|..|||.::.. |:..|.   
 Worm  5476 PKQEVKKEGEEPFFTKGLVDLWADRGDSFTLKCAVTGDPFPEIKWYRNGQLLRNGPRTVIETSPD 5540

Human   574 GVAELHIQDALPEDHGTYTCLAENALGQVSCSAWVTVHEKKSSRKSEYLLPVAPSKP-----TAP 633
            |...|.:.::...|.|.|.|.||||.|:....|  |.|.:.:..|:|        ||     ..|
 Worm  5541 GSCSLTVNESTMSDEGIYRCEAENAHGKAKTQA--TAHVQMALGKTE--------KPKMDEGKPP 5595

Human   634 IFLQGLSDLKVMDGSQVTMTVQVSGNPPPEVIWLHNGNEIQESEDFHFEQRGTQ--HSLCIQEVF 696
            .|:..|||:.|..|:.:.:..:|:|.|.|.|.|..:|..:.|...|.:....::  :.|.|:...
 Worm  5596 KFILELSDMSVSLGNVIDLECKVTGLPNPSVKWSKDGGPLIEDSRFEWSNEASKGVYQLRIKNAT 5660

Human   697 PEDTGTYTCEAWNSAGEVRTQA-----------VLTVQEPHDGTQPWFISKPRSVTASLGQSVLI 750
            ..|.|||.|.|.|..|...|::           |:|..:|     |.|..|...|..:.||.:.:
 Worm  5661 VHDEGTYRCVATNENGSATTKSFVRMDDGLGSGVVTASQP-----PRFTLKMGDVRTTEGQPLKL 5720

Human   751 SCAIAGDPFPTVHWLRDGKALCKDTGHFEV-LQNEDVFTLVLKKVQPWHAGQYEILLKNRVGECS 814
            .|.:...|.|.:.|.:|| |:...:...:: |..:.|.||::........|.|.::..|..|...
 Worm  5721 ECKVDASPLPEMVWYKDG-AIVTPSDRIQISLSPDGVATLLIPSCVYDDDGIYRVIATNPSGTAQ 5784

Human   815 CQVSLMLQNSSARALPRGREPASCEDLCGGGVGADGGGSDRYGSLRPGWPARGQGWLEEEDGEDV 879
            .:     ..::.:.|||                 |.|.                           
 Worm  5785 DK-----GTATVKKLPR-----------------DSGA--------------------------- 5800

Human   880 RGVLKRRVETRQHTEEAIRQQEVEQLDFRDLLGKKVSTKTLSEDDLKEIPAEQMDFRANLQRQVK 944
                :|..:                   ||:.....:.|.:...:...|| |:..||...:....
 Worm  5801 ----RRSAD-------------------RDVFDANKAPKLMEPLENIRIP-EKQSFRLRCKFSGD 5841

Human   945 PKTV----SEEER--------KVHSPQQV--------------DFRSVLAKK-GTSKTPVPEKVP 982
            ||..    .:.||        .:.||..|              .:|.|.... |:::|       
 Worm  5842 PKPTIKWFKDGERVFPYGRLQLIESPDGVCELVVDSATRQDAGGYRCVAENTYGSART------- 5899

Human   983 PPKPATPDFRSVLGGKKKLPAENGSSSAETLNAKAVESSKPLSNAQPSGPLKPVGNAKPAETLK- 1046
                 :.|...:.|.:|  |.:..||..|   .||...:.||:          :..|||.:::. 
 Worm  5900 -----SCDVNVIRGDRK--PRDIDSSIRE---GKAPGFTTPLT----------IRRAKPGDSVTF 5944

Human  1047 ---PMGNAKPA-ETLKPMGNAKPDENLK-SASKEELKKDVKNDV--------NC----KRGHAGT 1094
               |.||..|: :.||.......||.:| .|:.:..::.:.:||        .|    :.|.|.|
 Worm  5945 ECLPFGNPFPSIKWLKDGLELFSDEKIKMEAAADGTQRLILSDVTFLSEGYFRCVATNEHGTAST 6009

Human  1095 TDN---------------EKRSESQGTAPAFKQKLQDVHVAEGKKLLLQCQVSSDPPATIIWTLN 1144
            ...               |...|.:...|..::.|.::.:.||..:.:....:..|..|:.|..:
 Worm  6010 KAELVIEGDRTIGSRPLPEVNGEPEECKPRIRRGLYNMSIHEGNVVEMIVCATGIPTPTVKWYKD 6074

Human  1145 GKTL----KTTKFIILSQEGSLCSVSIEKALPEDRGLYKCVAKNDAGQAECSCQVTV----DDAP 1201
            |:.:    ...|.:|.:.|..:..:.|..|.|:|.|.|...|.|..|.|:....:.:    ..|.
 Worm  6075 GQEIVGDGPDGKRVIFTDERGIHHLVIVNASPDDEGEYSLEATNKLGSAKTEGSLNIIRPRHIAD 6139

Human  1202 ASENTKAP-------EMKSRRPKSSLPPVLGTESDATVKKKPAPKTPPKAAMPPQIIQFPEDQKV 1259
            |.|....|       ::|::...:.:|.:.    |..|...|||:                    
 Worm  6140 ADERGGMPFPPGFVRQLKNKHVFNHMPTIF----DCLVVGHPAPE-------------------- 6180

Human  1260 RAGESVELFGKVTGTQPITCTWMKFRKQIQESEHMKVENSENGS-KLTILAARQEHCGCYTLLVE 1323
                 ||              |....|:|.....:|:::...|| .|.||....|..|.|....:
 Worm  6181 -----VE--------------WFHNGKKIVPGGRIKIQSCGGGSHALIILDTTLEDAGEYVATAK 6226

Human  1324 NKLGSRQAQV-------------------------------NLTVVDKPDPPAGTPCASDIRSSS 1357
            |..||..:..                               .|.....|.||...|...::....
 Worm  6227 NSHGSASSSAVLDVTVPFLDSIKFNGEIDVTPYLTEEYGFKKLNTASLPTPPDRGPFIKEVTGHY 6291

Human  1358 LTLSWYGSSYDGGSAVQ-SYSIEIWDSANKTWKEL------ATCRSTSFNVQDLLPDHEYKFRVR 1415
            |||||..:........| :|.|||.:...|.|..|      ..|:     |::|.....|:||||
 Worm  6292 LTLSWIPTKRAPPRYPQVTYVIEIRELPEKQWSLLEYNIPEPVCK-----VRNLELGKSYQFRVR 6351

Human  1416 AINVYGTSEPSQESELTTVGEKPE--------------EPKDE---------------------- 1444
            |.|:||.|:||..|..:.:...|:              :|..|                      
 Worm  6352 AENIYGISDPSPASPPSRLMAPPQPVFDRRTNKVIPLLDPYAEKALDMRYSEQYACAPWFSPGVV 6416

Human  1445 ----------------------------------------------------------------- 1444
                                                                             
 Worm  6417 EKRYCAENDTLTIVLNVSGFPDPDIKWKFRGWDIDTSSPTSKCKVYTYGGSETTLAITGFSKENV 6481

Human  1445 --------------------------------------------VEVSDDDEKEPEVDYR----- 1460
                                                        ::|..|.|..||:.:.     
 Worm  6482 GQYQCFAKNDYGDAQQNIMVDLATRPNFIQPLVNKTFSSAQPMRMDVRVDGEPFPELKWMKEWRP 6546

Human  1461 -----------------------------------------------TVTINTE----------- 1467
                                                           |||:..|           
 Worm  6547 IVESSRIKFVQDGPYLCSLIINDPMWRDSGIYSCVAVNDAGQATTSCTVTVEAEGDYNDVELPRR 6611

Human  1468 ------QKVSDFYDI---EERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIM 1523
                  ::|.:.|:|   :|:|.:.  |..||:.||.|     |:.|.|......:.:.:.:.|.
 Worm  6612 RVTIESRRVRELYEISEKDEKLAAE--GAPFRVKEKAT-----GREFLAQLRPIDDALMRHVDIH 6669

Human  1524 NCLHHPKLVQCVDAF-EEKANIVMVLEIVSGGELFERIIDEDFELTE-----RE-CIK-YMRQIS 1580
            |.|.||.:||..... :||..:|:.....|..:....:.....|:.|     || |:: ::||:.
 Worm  6670 NSLDHPGIVQMHRVLRDEKLALVVFDNANSTIDGLSSLAHPGVEIAEPKGVNRETCVRVFVRQLL 6734

Human  1581 EGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLEN---AGSLKVLFGTPEFVAPEV 1642
            ..::::|...|.||||:||.|:..:   .::||.|||.||||..   .|.:|   |:||||:||:
 Worm  6735 LALKHMHDLRIAHLDLRPETILLQD---DKLKLADFGQARRLLRGLITGEIK---GSPEFVSPEI 6793

Human  1643 INYEPIGYATDMWSIGVICYILVSGLSPFMGDNDNETLANVTSATWDFDDEAFDEISDDAKDFIS 1707
            :...|:..||||||.||:.|:|::|||||.|||||||||||.|.  .||.......|.||.||:.
 Worm  6794 VRSYPLTLATDMWSTGVLTYVLLTGLSPFHGDNDNETLANVDSC--QFDSSPLGNFSYDAGDFVK 6856

Human  1708 NLLKKDMKNRLDCTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMA 1772
            .||.:...:||...:.|.|||:  :.:.::.:.||.|.::::..:.||.:....|:.......:.
 Worm  6857 KLLTEIPVSRLTVDEALDHPWI--NDEKLKTEPLSADTLREFKYQHKWLERRVFVQQTPSEQILE 6919

Human  1773 MISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKPYFSKTIRDL--------E 1829
            .|.|.:..::...:|.:|......|..:     :|....::.|....|..:..::.        :
 Worm  6920 AILGPATAQAQQNAPVAPEGRRPAEIYD-----YLRIQPKKPPPTVEYVPQPRKEHPPFIDEFGQ 6979

Human  1830 VVEGSAARFDCKIEGY-------------PDPEVVWFKDDQSIRESRHFQIDYDEDGNCSLIISD 1881
            :::|.|  || :.||.             |.|:    :.:|:..:||..:......|....|..|
 Worm  6980 LIDGDA--FD-RPEGTGFEGPHRQPPQIPPQPQ----RPNQAAHDSRRHEQQPQHQGQPQRIPVD 7037

Human  1882 VCGDD--DAKY 1890
            ..|..  |.:|
 Worm  7038 QYGRPLVDPRY 7048

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYLKXP_024309300.1 I-set 43..133 CDD:400151 21/89 (24%)
Ig strand B 60..64 CDD:409353 0/3 (0%)
Ig strand C 73..77 CDD:409353 1/3 (33%)
Ig strand E 99..103 CDD:409353 1/3 (33%)
Ig strand F 113..118 CDD:409353 1/4 (25%)
Ig strand G 126..129 CDD:409353 0/2 (0%)
I-set 171..260 CDD:400151 23/89 (26%)
Ig strand B 188..192 CDD:409353 1/3 (33%)
Ig strand C 201..205 CDD:409353 0/3 (0%)
Ig strand E 226..230 CDD:409353 1/3 (33%)
Ig strand F 240..245 CDD:409353 1/4 (25%)
Ig strand G 253..256 CDD:409353 0/2 (0%)
23ISL 261..422 CDD:435470 28/174 (16%)
I-set 424..514 CDD:400151 28/91 (31%)
Ig strand B 441..445 CDD:409543 0/3 (0%)
Ig strand C 454..458 CDD:409543 1/3 (33%)
Ig strand E 480..484 CDD:409543 1/3 (33%)
Ig strand F 494..499 CDD:409543 2/4 (50%)
Ig strand G 507..510 CDD:409543 2/2 (100%)
IgI_4_MYLK-like 523..610 CDD:409568 31/92 (34%)
Ig strand A 523..526 CDD:409568 1/4 (25%)
Ig strand A' 532..535 CDD:409568 1/2 (50%)
Ig strand B 540..548 CDD:409568 3/7 (43%)
Ig strand C 554..558 CDD:409568 1/3 (33%)
Ig strand C' 561..564 CDD:409568 2/2 (100%)
Ig strand D 568..572 CDD:409568 1/3 (33%)
Ig strand E 576..581 CDD:409568 1/4 (25%)
Ig strand F 589..597 CDD:409568 4/7 (57%)
Ig strand G 600..610 CDD:409568 2/9 (22%)
IgI_4_hemolin-like 633..722 CDD:409570 28/101 (28%)
Ig strand A 633..636 CDD:409570 1/2 (50%)
Ig strand A' 642..645 CDD:409570 0/2 (0%)
Ig strand B 650..657 CDD:409570 0/6 (0%)
Ig strand C 663..668 CDD:409570 2/4 (50%)
Ig strand C' 671..673 CDD:409570 0/1 (0%)
Ig strand D 678..682 CDD:409570 1/3 (33%)
Ig strand E 688..692 CDD:409570 1/3 (33%)
Ig strand F 701..709 CDD:409570 5/7 (71%)
Ig strand G 712..722 CDD:409570 3/20 (15%)
I-set 731..819 CDD:400151 21/88 (24%)
Ig strand B 748..752 CDD:409353 0/3 (0%)
Ig strand C 761..765 CDD:409353 0/3 (0%)
Ig strand E 787..791 CDD:409353 2/3 (67%)
Ig strand F 801..806 CDD:409353 1/4 (25%)
Ig strand G 814..817 CDD:409353 0/2 (0%)
I-set 1108..1197 CDD:400151 21/92 (23%)
Ig strand B 1125..1129 CDD:409353 0/3 (0%)
Ig strand C 1138..1142 CDD:409353 1/3 (33%)
Ig strand E 1163..1167 CDD:409353 0/3 (0%)
Ig strand F 1177..1182 CDD:409353 1/4 (25%)
Ig strand G 1190..1193 CDD:409353 0/2 (0%)
IgI_8_hMLCK_like 1247..1345 CDD:409419 20/129 (16%)
Ig strand A 1247..1251 CDD:409419 0/3 (0%)
Ig strand A' 1256..1260 CDD:409419 0/3 (0%)
Ig strand B 1264..1273 CDD:409419 2/8 (25%)
Ig strand C 1277..1283 CDD:409419 1/5 (20%)
Ig strand C' 1286..1288 CDD:409419 1/1 (100%)
Ig strand D 1294..1299 CDD:409419 1/4 (25%)
Ig strand E 1303..1308 CDD:409419 2/5 (40%)
Ig strand F 1316..1324 CDD:409419 2/7 (29%)
Ig strand G 1327..1337 CDD:409419 3/40 (8%)
FN3 1341..1433 CDD:238020 33/98 (34%)
STKc_MLCK1 1471..1729 CDD:271093 100/271 (37%)
IgI_telokin-like 1822..1909 CDD:409565 17/92 (18%)
Ig strand A 1822..1825 CDD:409565 0/2 (0%)
Ig strand A' 1827..1830 CDD:409565 0/10 (0%)
Ig strand B 1834..1843 CDD:409565 3/8 (38%)
Ig strand C 1848..1854 CDD:409565 1/5 (20%)
Ig strand C' 1857..1859 CDD:409565 1/1 (100%)
Ig strand D 1865..1870 CDD:409565 0/4 (0%)
Ig strand E 1873..1881 CDD:409565 2/7 (29%)
Ig strand F 1889..1896 CDD:409565 1/2 (50%)
Ig strand G 1899..1909 CDD:409565
unc-89NP_001020985.1 SH3 65..124 CDD:473055
RhoGEF 153..328 CDD:238091
PH_unc89 341..455 CDD:270134
Ig strand B 565..569 CDD:409405
I-set <570..638 CDD:400151
Ig strand C 578..582 CDD:409405
Ig strand E 604..608 CDD:409405
Ig strand F 618..623 CDD:409405
Ig strand G 631..634 CDD:409405
I-set 648..737 CDD:400151
Ig strand B 665..669 CDD:409353
Ig strand C 678..682 CDD:409353
Ig strand E 703..707 CDD:409353
Ig strand F 717..722 CDD:409353
Ig strand G 730..733 CDD:409353
I-set 748..837 CDD:400151
Ig strand B 765..769 CDD:409353
Ig strand C 778..782 CDD:409353
Ig strand E 803..807 CDD:409353
Ig strand F 817..822 CDD:409353
Ig strand G 830..833 CDD:409353
Ig 844..935 CDD:472250
Ig strand B 861..865 CDD:409405
Ig strand C 874..878 CDD:409405
Ig strand E 900..904 CDD:409405
Ig strand F 915..920 CDD:409405
Ig strand G 928..931 CDD:409405
Ig 946..1034 CDD:472250
Ig strand B 963..967 CDD:409543
Ig strand C 976..980 CDD:409543
Ig strand E 1002..1006 CDD:409543
Ig strand F 1010..1019 CDD:409543
Ig strand G 1027..1030 CDD:409543
I-set 1044..1133 CDD:400151
Ig strand B 1061..1065 CDD:409353
Ig strand C 1074..1078 CDD:409353
Ig strand E 1099..1103 CDD:409353
Ig strand F 1113..1118 CDD:409353
Ig strand G 1126..1129 CDD:409353
Ig 1140..1237 CDD:472250
Ig strand B 1157..1161 CDD:409543
Ig strand C 1170..1174 CDD:409543
Ig strand E 1200..1204 CDD:409543
Ig strand F 1208..1222 CDD:409543
Ig strand G 1230..1233 CDD:409543
PTZ00121 <1304..1992 CDD:173412
Ig 1982..2068 CDD:472250
Ig strand B 1999..2003 CDD:409353
Ig strand C 2010..2014 CDD:409353
Ig strand E 2036..2040 CDD:409353
Ig strand F 2048..2053 CDD:409353
Ig strand G 2061..2064 CDD:409353
I-set 2081..2164 CDD:400151
Ig strand B 2092..2096 CDD:409406
Ig strand C 2105..2109 CDD:409406
Ig strand E 2130..2134 CDD:409406
Ig strand F 2144..2149 CDD:409406
Ig strand G 2157..2160 CDD:409406
Ig 2171..2262 CDD:472250
Ig strand B 2188..2192 CDD:409353
Ig strand C 2202..2206 CDD:409353
Ig strand E 2226..2232 CDD:409353
Ig strand F 2242..2247 CDD:409353
Ig strand G 2255..2258 CDD:409353
I-set 2269..2360 CDD:400151
Ig strand B 2286..2290 CDD:409405
Ig strand C 2299..2303 CDD:409405
Ig strand E 2326..2330 CDD:409405
Ig strand F 2340..2345 CDD:409405
Ig strand G 2353..2356 CDD:409405
I-set 2367..2456 CDD:400151
Ig strand B 2384..2388 CDD:409543
Ig strand C 2397..2401 CDD:409543
Ig strand E 2422..2426 CDD:409543
Ig strand F 2436..2441 CDD:409543
Ig strand G 2449..2452 CDD:409543
Ig 2463..2554 CDD:472250
Ig strand B 2480..2484 CDD:409405
Ig strand C 2494..2498 CDD:409405
Ig strand E 2520..2524 CDD:409405
Ig strand F 2534..2539 CDD:409405
Ig strand G 2547..2550 CDD:409405
Ig 2563..2652 CDD:472250
Ig strand C 2593..2597 CDD:409405
Ig strand E 2618..2622 CDD:409405
Ig strand F 2632..2637 CDD:409405
Ig strand G 2645..2648 CDD:409405
I-set 2659..2747 CDD:400151
Ig strand B 2675..2679 CDD:409543
Ig strand C 2688..2692 CDD:409543
Ig strand E 2713..2717 CDD:409543
Ig strand F 2727..2732 CDD:409543
Ig strand G 2740..2743 CDD:409543
Ig 2754..2843 CDD:472250
Ig strand C 2784..2788 CDD:409353
Ig strand E 2809..2813 CDD:409353
Ig strand F 2824..2829 CDD:409353
Ig strand G 2837..2840 CDD:409353
I-set 2887..2981 CDD:400151
Ig strand B 2904..2908 CDD:409405
Ig strand C 2917..2921 CDD:409405
Ig strand E 2947..2951 CDD:409405
Ig strand F 2961..2966 CDD:409405
Ig strand G 2974..2977 CDD:409405
I-set 2994..3082 CDD:400151
Ig strand B 3011..3015 CDD:409353
Ig strand C 3024..3028 CDD:409353
Ig strand E 3046..3052 CDD:409353
Ig strand F 3062..3067 CDD:409353
Ig strand G 3075..3078 CDD:409353
Ig 3087..3183 CDD:472250
Ig strand B 3104..3108 CDD:409543
Ig strand C 3117..3121 CDD:409543
Ig strand E 3149..3154 CDD:409543
Ig strand F 3164..3169 CDD:409543
I-set 3189..3279 CDD:400151
Ig strand B 3206..3210 CDD:409405
Ig strand C 3218..3222 CDD:409405
Ig strand E 3245..3249 CDD:409405
Ig strand F 3259..3264 CDD:409405
Ig strand G 3272..3275 CDD:409405
I-set 3286..3377 CDD:400151
Ig strand B 3303..3307 CDD:409353
Ig strand C 3316..3320 CDD:409353
Ig strand E 3343..3347 CDD:409353
Ig strand F 3357..3362 CDD:409353
Ig strand G 3370..3373 CDD:409353
I-set 3384..3472 CDD:400151
Ig strand B 3401..3405 CDD:409405
Ig strand C 3414..3418 CDD:409405
Ig strand E 3441..3445 CDD:409405
Ig strand F 3455..3460 CDD:409405
Ig strand G 3468..3471 CDD:409405
I-set 3482..3573 CDD:400151
Ig strand B 3499..3503 CDD:409353
Ig strand C 3512..3516 CDD:409353
Ig strand E 3539..3543 CDD:409353
Ig strand F 3553..3558 CDD:409353
Ig strand G 3566..3569 CDD:409353
I-set 3580..3671 CDD:400151
Ig strand B 3597..3601 CDD:409405
Ig strand C 3610..3614 CDD:409405
Ig strand E 3637..3641 CDD:409405
Ig strand F 3651..3656 CDD:409405
Ig strand G 3664..3667 CDD:409405
I-set 3686..3776 CDD:400151
Ig strand B 3703..3707 CDD:409353
Ig strand C 3716..3720 CDD:409353
Ig strand E 3742..3746 CDD:409353
Ig strand F 3756..3761 CDD:409353
Ig strand G 3769..3772 CDD:409353
I-set 3817..3902 CDD:400151
Ig strand B 3834..3838 CDD:409543
Ig strand C 3847..3851 CDD:409543
Ig strand E 3873..3877 CDD:409543
Ig strand F 3887..3892 CDD:409543
Ig strand G 3900..3903 CDD:409543
I-set 3920..4010 CDD:400151
Ig strand B 3937..3941 CDD:409353
Ig strand C 3950..3954 CDD:409353
Ig strand E 3974..3980 CDD:409353
Ig strand F 3990..3995 CDD:409353
Ig strand G 4003..4006 CDD:409353
I-set 4018..4107 CDD:400151
Ig strand B 4035..4039 CDD:409353
Ig strand C 4047..4051 CDD:409353
Ig strand E 4073..4077 CDD:409353
Ig strand F 4087..4092 CDD:409353
Ig strand G 4100..4103 CDD:409353
Ig 4114..4202 CDD:472250
Ig strand B 4130..4134 CDD:409353
Ig strand C 4142..4146 CDD:409353
Ig strand F 4182..4187 CDD:409353
Ig strand G 4195..4198 CDD:409353
Ig 4212..4298 CDD:472250
Ig strand B 4229..4233 CDD:409543
Ig strand C 4241..4245 CDD:409543
Ig strand E 4264..4268 CDD:409543
Ig strand F 4278..4283 CDD:409543
Ig strand G 4291..4294 CDD:409543
I-set 4302..4388 CDD:400151
Ig strand B 4319..4323 CDD:409543
Ig strand C 4331..4335 CDD:409543
Ig strand E 4354..4358 CDD:409543
Ig strand F 4368..4373 CDD:409543
Ig strand G 4381..4384 CDD:409543
I-set 4400..4486 CDD:400151
Ig strand B 4417..4421 CDD:409543
Ig strand C 4429..4433 CDD:409543
Ig strand E 4452..4456 CDD:409543
Ig strand F 4466..4471 CDD:409543
Ig strand G 4479..4482 CDD:409543
Ig 4493..4582 CDD:472250
Ig strand B 4508..4512 CDD:409543
Ig strand C 4520..4524 CDD:409543
Ig strand E 4546..4550 CDD:409543
Ig strand F 4560..4565 CDD:409543
Ig strand G 4574..4577 CDD:409543
Ig 4588..4679 CDD:472250
Ig strand B 4605..4609 CDD:409543
Ig strand C 4617..4621 CDD:409543
Ig strand E 4645..4649 CDD:409543
Ig strand F 4659..4664 CDD:409543
Ig strand G 4672..4675 CDD:409543
I-set 4685..4772 CDD:400151
Ig strand B 4700..4704 CDD:409543
Ig strand C 4712..4716 CDD:409543
Ig strand E 4738..4742 CDD:409543
Ig strand F 4752..4757 CDD:409543
Ig strand G 4765..4768 CDD:409543
Ig 4781..4869 CDD:472250
Ig strand B 4797..4801 CDD:409353
Ig strand C 4810..4813 CDD:409353
Ig strand E 4835..4839 CDD:409353
Ig strand F 4849..4854 CDD:409353
Ig strand G 4862..4865 CDD:409353
Ig 4873..4962 CDD:472250
Ig strand B 4890..4894 CDD:409543
Ig strand C 4902..4906 CDD:409543
Ig strand E 4928..4932 CDD:409543
Ig strand F 4942..4947 CDD:409543
Ig strand G 4955..4958 CDD:409543
Ig 4979..5060 CDD:472250 3/11 (27%)
Ig strand B 4985..4989 CDD:409543
Ig strand C 4997..5001 CDD:409543
Ig strand E 5025..5029 CDD:409543
Ig strand F 5039..5044 CDD:409543
Ig strand G 5052..5055 CDD:409543 0/2 (0%)
I-set 5073..5161 CDD:400151 21/87 (24%)
Ig strand B 5088..5092 CDD:409353 0/3 (0%)
Ig strand C 5101..5105 CDD:409353 1/3 (33%)
Ig strand E 5127..5131 CDD:409353 1/3 (33%)
Ig strand F 5141..5146 CDD:409353 1/4 (25%)
Ig strand G 5154..5157 CDD:409353 0/2 (0%)
I-set 5171..5260 CDD:400151 23/88 (26%)
Ig strand B 5188..5192 CDD:409405 1/3 (33%)
Ig strand C 5201..5205 CDD:409405 0/3 (0%)
Ig strand E 5227..5231 CDD:409405 1/3 (33%)
Ig strand F 5241..5246 CDD:409405 1/4 (25%)
Ig strand G 5256..5259 CDD:409405 0/2 (0%)
Ig 5277..5367 CDD:472250 21/130 (16%)
Ig strand B 5294..5298 CDD:409353 0/3 (0%)
Ig strand C 5307..5311 CDD:409353 1/3 (33%)
Ig strand E 5333..5337 CDD:409353 1/3 (33%)
Ig strand F 5347..5352 CDD:409353 1/4 (25%)
Ig strand G 5360..5363 CDD:409353 0/8 (0%)
I-set 5383..5473 CDD:400151 28/89 (31%)
Ig strand B 5400..5404 CDD:409353 0/3 (0%)
Ig strand C 5413..5417 CDD:409353 1/3 (33%)
Ig strand E 5439..5443 CDD:409353 1/3 (33%)
Ig strand F 5453..5458 CDD:409353 2/4 (50%)
Ig strand G 5466..5469 CDD:409353 0/2 (0%)
I-set 5487..5577 CDD:400151 32/91 (35%)
Ig strand B 5504..5508 CDD:409353 2/3 (67%)
Ig strand C 5517..5521 CDD:409353 1/3 (33%)
Ig strand E 5543..5547 CDD:409353 1/3 (33%)
Ig strand F 5557..5562 CDD:409353 2/4 (50%)
Ig strand G 5571..5574 CDD:409353 1/4 (25%)
I-set 5595..5684 CDD:400151 27/88 (31%)
Ig strand C 5625..5629 CDD:409353 1/3 (33%)
Ig strand E 5650..5656 CDD:409353 1/5 (20%)
Ig strand F 5666..5671 CDD:409353 3/4 (75%)
Ig strand G 5680..5683 CDD:409353 1/2 (50%)
I-set 5701..5791 CDD:400151 21/95 (22%)
Ig strand B 5718..5722 CDD:409405 0/3 (0%)
Ig strand C 5731..5735 CDD:409405 0/3 (0%)
Ig strand E 5757..5761 CDD:409405 2/3 (67%)
Ig strand F 5771..5776 CDD:409405 1/4 (25%)
Ig 5815..5905 CDD:472250 18/102 (18%)
Ig strand B 5832..5836 CDD:409543 2/3 (67%)
Ig strand C 5845..5849 CDD:409543 0/3 (0%)
Ig strand E 5871..5875 CDD:409543 0/3 (0%)
Ig strand F 5885..5890 CDD:409543 1/4 (25%)
Ig strand G 5898..5901 CDD:409543 1/14 (7%)
I-set 5925..6015 CDD:400151 21/99 (21%)
Ig strand B 5942..5946 CDD:409405 0/3 (0%)
Ig strand C 5955..5959 CDD:409405 0/3 (0%)
Ig strand E 5981..5985 CDD:409405 0/3 (0%)
Ig strand F 5995..6000 CDD:409405 1/4 (25%)
Ig strand G 6008..6011 CDD:409405 1/2 (50%)
I-set 6038..6131 CDD:400151 21/92 (23%)
Ig strand B 6055..6059 CDD:409353 0/3 (0%)
Ig strand C 6068..6072 CDD:409353 1/3 (33%)
Ig strand E 6097..6101 CDD:409353 0/3 (0%)
Ig strand F 6111..6116 CDD:409353 1/4 (25%)
Ig strand G 6124..6127 CDD:409353 0/2 (0%)
Ig 6150..6240 CDD:472250 24/132 (18%)
Ig strand B 6167..6171 CDD:409405 0/7 (0%)
Ig strand C 6180..6184 CDD:409405 2/42 (5%)
Ig strand E 6206..6210 CDD:409405 1/3 (33%)
Ig strand F 6220..6225 CDD:409405 1/4 (25%)
Ig strand G 6233..6236 CDD:409405 0/2 (0%)
FN3 6275..6358 CDD:214495 28/87 (32%)
Ig <6433..6495 CDD:472250 0/61 (0%)
Ig strand C 6440..6444 CDD:409543 0/3 (0%)
Ig strand E 6469..6473 CDD:409543 0/3 (0%)
Ig strand F 6483..6488 CDD:409543 0/4 (0%)
IgI_telokin-like 6510..6597 CDD:409565 7/86 (8%)
Ig strand A 6510..6513 CDD:409565 0/2 (0%)
Ig strand A' 6515..6518 CDD:409565 0/2 (0%)
Ig strand B 6522..6531 CDD:409565 1/8 (13%)
Ig strand C 6536..6542 CDD:409565 2/5 (40%)
Ig strand C' 6545..6547 CDD:409565 0/1 (0%)
Ig strand D 6553..6558 CDD:409565 0/4 (0%)
Ig strand E 6561..6569 CDD:409565 0/7 (0%)
Ig strand F 6577..6584 CDD:409565 0/6 (0%)
Ig strand G 6587..6597 CDD:409565 2/9 (22%)
PK_Unc-89_rpt1 6620..6878 CDD:271011 101/272 (37%)
I-set 7528..7616 CDD:400151
Ig strand B 7545..7549 CDD:409405
Ig strand C 7558..7562 CDD:409405
Ig strand E 7583..7587 CDD:409405
Ig strand F 7597..7602 CDD:409405
Ig strand G 7610..7613 CDD:409405
FN3 7621..7716 CDD:238020
STKc_Unc-89_rpt2 7781..8035 CDD:271014
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.