DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYL5 and sqh

DIOPT Version :9

Sequence 1:XP_006713949.1 Gene:MYL5 / 4636 HGNCID:7586 Length:328 Species:Homo sapiens
Sequence 2:NP_001284928.1 Gene:sqh / 31554 FlyBaseID:FBgn0003514 Length:174 Species:Drosophila melanogaster


Alignment Length:177 Identity:90/177 - (50%)
Similarity:119/177 - (67%) Gaps:8/177 - (4%)


- Green bases have known domain annotations that are detailed below.


Human   153 RRPEASRKTKKKEGGALRAQRASSNVFSNFEQTQIQEFKEAFTLMDQNRDGFIDKEDLKDTYASL 217
            |:....|.|.||     |||||:||||:.|:|.||.||||||.::|||||||::||||.|..|||
  Fly     4 RKTAGRRATTKK-----RAQRATSNVFAMFDQAQIAEFKEAFNMIDQNRDGFVEKEDLHDMLASL 63

Human   218 GKTNVKDDELDAMLKEASGPINFTMFLNLFGEKLSGTDAEETILNAFKMLDPDGKGKINKEYIKR 282
            || |..||.||.|:.||.|||||||||.||||:|.|||.|:.|.|||...|.:..|.:.::.::.
  Fly    64 GK-NPTDDYLDGMMNEAPGPINFTMFLTLFGERLQGTDPEDVIKNAFGCFDEENMGVLPEDRLRE 127

Human   283 LLMSQADKMTAEEVDQMFQFASIDVAGNLDYKALSYVITHG-EEKEE 328
            ||.:..|:.|.|:||:|::.|.|. .|..||...:.::.|| ::|:|
  Fly   128 LLTTMGDRFTDEDVDEMYREAPIK-NGLFDYLEFTRILKHGAKDKDE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYL5XP_006713949.1 FRQ1 170..314 CDD:227455 80/143 (56%)
EFh 189..247 CDD:238008 40/57 (70%)
EFh 263..314 CDD:238008 16/50 (32%)
sqhNP_001284928.1 FRQ1 15..170 CDD:227455 84/161 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 108 1.000 Domainoid score I6417
eggNOG 1 0.900 - - E2759_KOG0031
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435392at2759
OrthoFinder 1 1.000 - - FOG0000218
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23049
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X162
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.