DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYL3 and Mlc1

DIOPT Version :10

Sequence 1:NP_000249.1 Gene:MYL3 / 4634 HGNCID:7584 Length:195 Species:Homo sapiens
Sequence 2:NP_476639.1 Gene:Mlc1 / 43323 FlyBaseID:FBgn0002772 Length:155 Species:Drosophila melanogaster


Alignment Length:116 Identity:50/116 - (43%)
Similarity:71/116 - (61%) Gaps:6/116 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    77 GDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVFD 141
            ||.||||..|||.|.:.::.|..::   |.|.:..:.|||:...:.|.|:.|.||||:|.|:::|
  Fly    32 GDALRALNLNPTLALIEKLGGTKKR---NEKKIKLDEFLPIYSQVKKEKEQGCYEDFIECLKLYD 93

Human   142 KEGNGTVMGAELRHVLATLGERLTEDEVEKLMA---GQEDSNGCINYEAFV 189
            ||.|||::.|||:|.|..|||.|.:::||.|.|   ..||..|.|.|..|:
  Fly    94 KEENGTMLLAELQHALLALGESLDDEQVETLFADCMDPEDDEGFIPYSPFL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYL3NP_000249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
PTZ00184 44..194 CDD:185504 50/116 (43%)
Mlc1NP_476639.1 PTZ00184 1..150 CDD:185504 50/116 (43%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.