DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYL3 and CG17272

DIOPT Version :10

Sequence 1:NP_000249.1 Gene:MYL3 / 4634 HGNCID:7584 Length:195 Species:Homo sapiens
Sequence 2:NP_650917.1 Gene:CG17272 / 42465 FlyBaseID:FBgn0038830 Length:149 Species:Drosophila melanogaster


Alignment Length:152 Identity:42/152 - (27%)
Similarity:73/152 - (48%) Gaps:24/152 - (15%)


- Green bases have known domain annotations that are detailed below.


Human    46 FTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGD------VLRALGQNPTQAEVLRVLGKPRQEEL 104
            |..:.|:||:|.|.||.|:         ||..:      ::|:||.:||..|::..|     ::.
  Fly     5 FKEQDIDEFRECFYLFARS---------GQINNLDELTVIMRSLGLSPTIQELVSYL-----KQK 55

Human   105 NTKMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEV 169
            |.| |.|..||.::...||.:...  ::.:...:..|.:..||:...:||::|...||.|:..||
  Fly    56 NGK-MSFADFLDIMHQHSKVESLP--DEVIAAFKAADPQNKGTISARQLRNLLQNWGEGLSMREV 117

Human   170 EKLM-AGQEDSNGCINYEAFVK 190
            :.:. ....::|..:.|..|||
  Fly   118 DNIFREANVNNNSTVRYADFVK 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYL3NP_000249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
PTZ00184 44..194 CDD:185504 42/152 (28%)
CG17272NP_650917.1 PTZ00184 1..143 CDD:185504 42/152 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.