DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYL3 and CG13898

DIOPT Version :10

Sequence 1:NP_000249.1 Gene:MYL3 / 4634 HGNCID:7584 Length:195 Species:Homo sapiens
Sequence 2:NP_612058.1 Gene:CG13898 / 38092 FlyBaseID:FBgn0035161 Length:151 Species:Drosophila melanogaster


Alignment Length:141 Identity:39/141 - (27%)
Similarity:71/141 - (50%) Gaps:7/141 - (4%)


- Green bases have known domain annotations that are detailed below.


Human    49 EQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFET 113
            :.:::..|||.|.|  |:...:|.....|:|:|.||||.|::|:.| ..:..:.::| ..:....
  Fly    11 DDLQDICEAFELCD--PEKTGRIRADDLGEVMRTLGQNHTESEIYR-YSEGLEGDVN-GYIQLTD 71

Human   114 FLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQE- 177
            |:.::..|.....:..|  .......||.:.:|.|...|||||...|||:::::|..::....: 
  Fly    72 FIDLMTKIYSAMGSSDY--LKAAYNAFDFDKDGLVTYGELRHVFINLGEKISDEEFNEVFRQADV 134

Human   178 DSNGCINYEAF 188
            |.:|.||:..|
  Fly   135 DGDGVINFRDF 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYL3NP_000249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
PTZ00184 44..194 CDD:185504 39/141 (28%)
CG13898NP_612058.1 PTZ00184 8..146 CDD:185504 39/141 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.