DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYL3 and azot

DIOPT Version :10

Sequence 1:NP_000249.1 Gene:MYL3 / 4634 HGNCID:7584 Length:195 Species:Homo sapiens
Sequence 2:NP_610336.1 Gene:azot / 35751 FlyBaseID:FBgn0033238 Length:148 Species:Drosophila melanogaster


Alignment Length:135 Identity:43/135 - (31%)
Similarity:75/135 - (55%) Gaps:7/135 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    56 EAFMLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQH 120
            :.|.:.|:..  |..||..:...|:||||:.|..|||..::.:. ..|.|..::..| |..::  
  Fly    14 DTFRILDKDN--EGAITSKEMAVVIRALGRQPNDAEVQSMINEV-DSEGNGSIVAPE-FCNVI-- 72

Human   121 ISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQE-DSNGCIN 184
            :.|.:||...::..|..|:|||:.||.:...||::|...||.:|::||:|:::...: |.:..:|
  Fly    73 LRKMRDTNHEDELREAFRIFDKDNNGYITTTELKNVFTALGVKLSDDELEEMIREYDLDQDNHLN 137

Human   185 YEAFV 189
            ||.||
  Fly   138 YEEFV 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYL3NP_000249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
PTZ00184 44..194 CDD:185504 43/135 (32%)
azotNP_610336.1 PTZ00184 1..148 CDD:185504 43/135 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.