DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MYL3 and Mlc-c

DIOPT Version :10

Sequence 1:NP_000249.1 Gene:MYL3 / 4634 HGNCID:7584 Length:195 Species:Homo sapiens
Sequence 2:NP_001245533.1 Gene:Mlc-c / 31474 FlyBaseID:FBgn0004687 Length:153 Species:Drosophila melanogaster


Alignment Length:153 Identity:75/153 - (49%)
Similarity:104/153 - (67%) Gaps:8/153 - (5%)


- Green bases have known domain annotations that are detailed below.


Human    42 IKIEFTPEQIEEFKEAFMLFDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNT 106
            :|..||  .:|||:|||.|||.  :.:.||...|.|:.|||||||||:::|.:...:.:.:|   
  Fly     8 VKQTFT--TLEEFQEAFNLFDN--RGDGKIQLSQVGECLRALGQNPTESDVKKCTHQLKPDE--- 65

Human   107 KMMDFETFLPMLQHISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEK 171
             .:.||.|||:.|.|||.:...|.:||:||||.|||:.:|.:..|||||:|.||||:||::|||:
  Fly    66 -RISFEVFLPIYQAISKARSGDTADDFIEGLRHFDKDASGYISSAELRHLLTTLGEKLTDEEVEQ 129

Human   172 LMAGQEDSNGCINYEAFVKHIMS 194
            |:|..||..|.||||.||:.:||
  Fly   130 LLANMEDQQGNINYEEFVRMVMS 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MYL3NP_000249.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..37
PTZ00184 44..194 CDD:185504 72/149 (48%)
Mlc-cNP_001245533.1 PTZ00184 14..152 CDD:185504 70/143 (49%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.