DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-SGDH and ndufb5

DIOPT Version :9

Sequence 1:NP_001261742.1 Gene:ND-SGDH / 46260 FlyBaseID:FBgn0011455 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001099066.1 Gene:ndufb5 / 797063 ZFINID:ZDB-GENE-011010-1 Length:186 Species:Danio rerio


Alignment Length:174 Identity:70/174 - (40%)
Similarity:101/174 - (58%) Gaps:7/174 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGWSRLLSPAAKFASYRAVLQEPACRNALHQQLRR------MGGDHGHHQMIIKPSRFQWDKFK 59
            |||.|...|.||..|....:.:.....|.|.:.:.|      ..|.||....:|:||.|...:|.
Zfish     1 MVGMSIFRSAAAFTARLNPLKRTSQSSNLLSRAVARSEQVVVRHGSHGKRMFMIQPSSFYDKRFL 65

  Fly    60 DLLHFYVMLGVIPVTALVLYANIFVGPAQLAEIPEGYEPKHWEYEKHPISRFISRYILNSDQQNY 124
            .||.|||:|..||:...|...|:|:|..:|||.||||||:||||.||||:|:|:||:.:|..::|
Zfish    66 KLLKFYVLLTGIPMAVFVTSVNVFIGDCELAETPEGYEPEHWEYYKHPITRWIARYVYDSPVKDY 130

  Fly   125 EKSLHYLYEENEKAQIRLLEDEVRRKMSERNDYQAYYYRPSVAK 168
            ||.|..:..|.|||::|.:.:|||:.|.|:.| ..::..|::.|
Zfish   131 EKMLALIQMETEKAEMRKMHNEVRQHMREKGD-GPWFQIPTIDK 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-SGDHNP_001261742.1 NDUF_B5 1..179 CDD:286821 70/174 (40%)
ndufb5NP_001099066.1 NDUF_B5 1..185 CDD:286821 70/174 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170594631
Domainoid 1 1.000 128 1.000 Domainoid score I5280
eggNOG 1 0.900 - - E1_KOG4632
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31093
Inparanoid 1 1.050 128 1.000 Inparanoid score I4651
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251699at2759
OrthoFinder 1 1.000 - - FOG0006923
OrthoInspector 1 1.000 - - oto41706
orthoMCL 1 0.900 - - OOG6_108543
Panther 1 1.100 - - LDO PTHR13178
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3361
SonicParanoid 1 1.000 - - X5831
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1514.830

Return to query results.
Submit another query.