DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-SGDH and Ndufb5

DIOPT Version :9

Sequence 1:NP_001261742.1 Gene:ND-SGDH / 46260 FlyBaseID:FBgn0011455 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_079592.2 Gene:Ndufb5 / 66046 MGIID:1913296 Length:189 Species:Mus musculus


Alignment Length:127 Identity:64/127 - (50%)
Similarity:84/127 - (66%) Gaps:0/127 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RMGGDHGHHQMIIKPSRFQWDKFKDLLHFYVMLGVIPVTALVLYANIFVGPAQLAEIPEGYEPKH 100
            |..||||....::|||.:...:|..|:.||:||..|||...:...|||:|.|:||||||||.|:|
Mouse    45 RHSGDHGKRLFVVKPSLYYDARFLRLMKFYLMLTGIPVIIGITLVNIFIGEAELAEIPEGYIPEH 109

  Fly   101 WEYEKHPISRFISRYILNSDQQNYEKSLHYLYEENEKAQIRLLEDEVRRKMSERNDYQAYYY 162
            |||.||||||:|:|...:..::||||:|..|..|:|||::||.|.||||.|..|.|...|.:
Mouse   110 WEYYKHPISRWIARNFYDGPEKNYEKTLAILQIESEKAELRLKEQEVRRLMRARGDGPWYQF 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-SGDHNP_001261742.1 NDUF_B5 1..179 CDD:286821 64/127 (50%)
Ndufb5NP_079592.2 NDUF_B5 1..188 CDD:401654 64/127 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849077
Domainoid 1 1.000 129 1.000 Domainoid score I5253
eggNOG 1 0.900 - - E1_KOG4632
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31093
Inparanoid 1 1.050 129 1.000 Inparanoid score I4637
Isobase 1 0.950 - 0 Normalized mean entropy S5528
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006923
OrthoInspector 1 1.000 - - oto92859
orthoMCL 1 0.900 - - OOG6_108543
Panther 1 1.100 - - LDO PTHR13178
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3361
SonicParanoid 1 1.000 - - X5831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.730

Return to query results.
Submit another query.