DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-SGDH and ndufb5

DIOPT Version :9

Sequence 1:NP_001261742.1 Gene:ND-SGDH / 46260 FlyBaseID:FBgn0011455 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_001017303.1 Gene:ndufb5 / 550057 XenbaseID:XB-GENE-970652 Length:186 Species:Xenopus tropicalis


Alignment Length:176 Identity:71/176 - (40%)
Similarity:97/176 - (55%) Gaps:22/176 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MVGWSRLLSPAAKFASYRAVLQEP--------ACRNALHQQLRRMG------GDHGHHQMIIKPS 51
            |.|.|.|.|.||      ||.:.|        .|  .|.:.|.:.|      |.||....:::||
 Frog     1 MAGMSLLTSAAA------AVRRLPFTNRGLFAGC--VLRKSLPQPGSVPVRFGSHGKRLFVMQPS 57

  Fly    52 RFQWDKFKDLLHFYVMLGVIPVTALVLYANIFVGPAQLAEIPEGYEPKHWEYEKHPISRFISRYI 116
            .|...:|..||.||::|..:|..|.:.:.|||:|.|:||||||||.|:||||.||||:|::.|.:
 Frog    58 HFYDRRFLRLLKFYILLTAVPAAAFITFVNIFIGEAELAEIPEGYVPEHWEYYKHPITRWLCRNL 122

  Fly   117 LNSDQQNYEKSLHYLYEENEKAQIRLLEDEVRRKMSERNDYQAYYY 162
            .:|.::.|||.:..:..|.|||..||.:.|.||.|.||.|...|:|
 Frog   123 FDSPEKEYEKMMALVNIEAEKADFRLKKLEARRLMRERGDGPWYHY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-SGDHNP_001261742.1 NDUF_B5 1..179 CDD:286821 71/176 (40%)
ndufb5NP_001017303.1 NDUF_B5 1..185 CDD:370686 71/176 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5539
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31093
Inparanoid 1 1.050 123 1.000 Inparanoid score I4583
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251699at2759
OrthoFinder 1 1.000 - - FOG0006923
OrthoInspector 1 1.000 - - oto103126
Panther 1 1.100 - - LDO PTHR13178
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3361
SonicParanoid 1 1.000 - - X5831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.100

Return to query results.
Submit another query.