DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-SGDH and NDUFB5

DIOPT Version :10

Sequence 1:NP_652042.1 Gene:ND-SGDH / 46260 FlyBaseID:FBgn0011455 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_002483.1 Gene:NDUFB5 / 4711 HGNCID:7700 Length:189 Species:Homo sapiens


Alignment Length:143 Identity:67/143 - (46%)
Similarity:88/143 - (61%) Gaps:7/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RMGGDHGHHQMIIKPSRFQWDKFKDLLHFYVMLGVIPVTALVLYANIFVGPAQLAEIPEGYEPKH 100
            |..||||....:|:||||...:|..||.||:.|..|||...:...|:|:|.|:||||||||.|:|
Human    45 RHSGDHGKRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEH 109

  Fly   101 WEYEKHPISRFISRYILNSDQQNYEKSLHYLYEENEKAQIRLLEDEVRRKMSERNDYQAYYYRPS 165
            |||.||||||:|:|...:|.::.||:::..|..|.|||::|:.|.|||:.|..|.|...||    
Human   110 WEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYY---- 170

  Fly   166 VAKYHRISKEAAD 178
               |..|.||..|
Human   171 ---YETIDKELID 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-SGDHNP_652042.1 NDUF_B5 1..180 CDD:430820 67/143 (47%)
NDUFB5NP_002483.1 NDUF_B5 1..189 CDD:430820 67/143 (47%)

Return to query results.
Submit another query.