DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-SGDH and NDUFB5

DIOPT Version :9

Sequence 1:NP_001261742.1 Gene:ND-SGDH / 46260 FlyBaseID:FBgn0011455 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_002483.1 Gene:NDUFB5 / 4711 HGNCID:7700 Length:189 Species:Homo sapiens


Alignment Length:143 Identity:67/143 - (46%)
Similarity:88/143 - (61%) Gaps:7/143 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RMGGDHGHHQMIIKPSRFQWDKFKDLLHFYVMLGVIPVTALVLYANIFVGPAQLAEIPEGYEPKH 100
            |..||||....:|:||||...:|..||.||:.|..|||...:...|:|:|.|:||||||||.|:|
Human    45 RHSGDHGKRLFVIRPSRFYDRRFLKLLRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEH 109

  Fly   101 WEYEKHPISRFISRYILNSDQQNYEKSLHYLYEENEKAQIRLLEDEVRRKMSERNDYQAYYYRPS 165
            |||.||||||:|:|...:|.::.||:::..|..|.|||::|:.|.|||:.|..|.|...||    
Human   110 WEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYY---- 170

  Fly   166 VAKYHRISKEAAD 178
               |..|.||..|
Human   171 ---YETIDKELID 180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-SGDHNP_001261742.1 NDUF_B5 1..179 CDD:286821 67/143 (47%)
NDUFB5NP_002483.1 NDUF_B5 1..188 CDD:313073 67/143 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158678
Domainoid 1 1.000 129 1.000 Domainoid score I5297
eggNOG 1 0.900 - - E1_KOG4632
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31093
Inparanoid 1 1.050 128 1.000 Inparanoid score I4674
Isobase 1 0.950 - 0 Normalized mean entropy S5528
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1251699at2759
OrthoFinder 1 1.000 - - FOG0006923
OrthoInspector 1 1.000 - - oto89290
orthoMCL 1 0.900 - - OOG6_108543
Panther 1 1.100 - - LDO PTHR13178
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3361
SonicParanoid 1 1.000 - - X5831
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.740

Return to query results.
Submit another query.