DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-SGDH and C25H3.9

DIOPT Version :9

Sequence 1:NP_001261742.1 Gene:ND-SGDH / 46260 FlyBaseID:FBgn0011455 Length:186 Species:Drosophila melanogaster
Sequence 2:NP_741000.2 Gene:C25H3.9 / 173963 WormBaseID:WBGene00016118 Length:186 Species:Caenorhabditis elegans


Alignment Length:164 Identity:49/164 - (29%)
Similarity:88/164 - (53%) Gaps:19/164 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSPAAKFASYRAVLQE-----PACRNALHQQLRRMGGDHGHHQMIIKPSRFQWDKFKDLLHFY-V 66
            ::|||..|...|.|:.     ||.|::.....|:..|     |:|:       ::.||:.||| :
 Worm     7 MAPAAACACRSAFLKPSTSVIPAIRSSHAAVFRKRPG-----QLIV-------NRIKDVCHFYFI 59

  Fly    67 MLGVIPVTALVLYANIFVGPAQLAEIP-EGYEPKHWEYEKHPISRFISRYILNSDQQNYEKSLHY 130
            .:|.:||...:.|.:|..|..:|.:.| ||..|.||::|:.||.::.:::...||.:::|::|.|
 Worm    60 GIGFLPVLFCLAYNHIVYGTCELKDYPTEGPAPHHWQFERTPIRQWWAKWFGVSDVEHHERNLAY 124

  Fly   131 LYEENEKAQIRLLEDEVRRKMSERNDYQAYYYRP 164
            ..::...|:.|.:|..|:....||.||:.:.|:|
 Worm   125 YEKQGILARWRQIEQRVKHLEGERWDYKGWSYQP 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ND-SGDHNP_001261742.1 NDUF_B5 1..179 CDD:286821 49/164 (30%)
C25H3.9NP_741000.2 NDUF_B5 1..167 CDD:286821 49/164 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166235
Domainoid 1 1.000 74 1.000 Domainoid score I5983
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I3873
Isobase 1 0.950 - 0 Normalized mean entropy S5528
OMA 1 1.010 - - QHG28616
OrthoDB 1 1.010 - - D1251699at2759
OrthoFinder 1 1.000 - - FOG0006923
OrthoInspector 1 1.000 - - oto17395
orthoMCL 1 0.900 - - OOG6_108543
Panther 1 1.100 - - LDO PTHR13178
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3361
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.890

Return to query results.
Submit another query.