DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym87 and SHB17

DIOPT Version :9

Sequence 1:NP_652041.2 Gene:Pglym87 / 46246 FlyBaseID:FBgn0011270 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_012969.1 Gene:SHB17 / 853917 SGDID:S000001751 Length:271 Species:Saccharomyces cerevisiae


Alignment Length:242 Identity:57/242 - (23%)
Similarity:96/242 - (39%) Gaps:60/242 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RIVMVRHGESEWNQKNLFCGWFDAKLSEKGQQEACAAGKA-------LKDAKIEFDVAHTSVLTR 100
            |.::||||::||::...:.|..|..|:..|:.:....|::       |....|.:  ..||...|
Yeast     7 RCIIVRHGQTEWSKSGQYTGLTDLPLTPYGEGQMLRTGESVFRNNQFLNPDNITY--IFTSPRLR 69

  Fly   101 AQETLRAALK--SSEHK-KIPVCTTWRLNERHYGGLTGL---NKAETAKKFGEEKVK---IWRRS 156
            |::|:...||  |.|.: ||.|.....|.|..||...|:   ...|..|..|.:|.:   |||. 
Yeast    70 ARQTVDLVLKPLSDEQRAKIRVVVDDDLREWEYGDYEGMLTREIIELRKSRGLDKERPWNIWRD- 133

  Fly   157 FDTPPPPMEKDHEYYACIVEDPRYKDQLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMR-- 219
                           .|             |....::.:.|.:.|.:.....:......:|..  
Yeast   134 ---------------GC-------------ENGETTQQIGLRLSRAIARIQNLHRKHQSEGRASD 170

  Fly   220 VLIAAHGNSLR---------GVVKHLECISD-KDIMSLNLPTGIPFV 256
            :::.|||::||         ||.|..|.|.: :::.|.:..| :|:|
Yeast   171 IMVFAHGHALRYFAAIWFGLGVQKKCETIEEIQNVKSYDDDT-VPYV 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym87NP_652041.2 gpmA 42..292 CDD:184516 57/242 (24%)
SHB17NP_012969.1 His_Phos_1 9..192 CDD:395236 47/213 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.