DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym87 and GPM2

DIOPT Version :9

Sequence 1:NP_652041.2 Gene:Pglym87 / 46246 FlyBaseID:FBgn0011270 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_010263.1 Gene:GPM2 / 851541 SGDID:S000002179 Length:311 Species:Saccharomyces cerevisiae


Alignment Length:303 Identity:96/303 - (31%)
Similarity:148/303 - (48%) Gaps:59/303 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IVMVRHGESEWNQKNLFCGWFDAKLSEKGQQEACAAGKALK------DAKIEFDVAHTSVLTRAQ 102
            :.::|||:||.|.:|:||||.||||:|||:::|..:.:.::      :.::. .:.:||.|.|.|
Yeast    12 LFLLRHGQSELNHENIFCGWIDAKLTEKGKEQARHSAELIEQYCKANNLRLP-QIGYTSRLIRTQ 75

  Fly   103 ETLRAALK--------------------------SSEHKKIPVCTTWRLNERHYGGLTGLNKAET 141
            :|:....:                          ..::.|||:..||||||||||...|..|...
Yeast    76 QTIETMCEEFKLKPQLQVVYDFNKIKLGDEFGSDDKDNMKIPILQTWRLNERHYGSWQGQRKPNV 140

  Fly   142 AKKFGEEKVKIWRRSFDTPPPPMEKDHEYYACIVEDPRYKDQLKPEEF----------------- 189
            .|::|::|....||.::..|||::.|.|    :::....|......||                 
Yeast   141 LKEYGKDKYMFIRRDYEGKPPPVDLDRE----MIQQENEKGSSTGYEFKEPNRQIKYELECSNHD 201

  Fly   190 ---PKSESLKLTIERTLPYWNEVIVPQIK--DGMRVLIAAHGNSLRGVVKHLECISDKDIMSLNL 249
               |.||||:..:.|..|:...||:....  |....||..||:|:|.::|.||.|||.||.::::
Yeast   202 IVLPDSESLREVVYRLNPFLQNVILKLANQYDESSCLIVGHGSSVRSLLKILEGISDDDIKNVDI 266

  Fly   250 PTGIPFVYELDESLKPLATLKFLGDPETVKKAMESVANQGKAK 292
            |.|||.|.|||::.......||..|||:.|...|.|.|:|..|
Yeast   267 PNGIPLVVELDKNNGLKFIRKFYLDPESAKINAEKVRNEGFIK 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym87NP_652041.2 gpmA 42..292 CDD:184516 95/301 (32%)
GPM2NP_010263.1 GpmA 9..292 CDD:223661 87/284 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346325
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X392
TreeFam 1 0.960 - -
54.700

Return to query results.
Submit another query.