DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym87 and PGM

DIOPT Version :9

Sequence 1:NP_652041.2 Gene:Pglym87 / 46246 FlyBaseID:FBgn0011270 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_177928.2 Gene:PGM / 844140 AraportID:AT1G78050 Length:332 Species:Arabidopsis thaliana


Alignment Length:281 Identity:100/281 - (35%)
Similarity:140/281 - (49%) Gaps:69/281 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SKSSSGGKQAEKKGKYR---IVMVRHGESEWNQKNLFCGWFDAKLSEKGQQEACAAGKALKDAKI 88
            |.|.|..|..|.|.|..   ::::|||||.||:||||.|..|..|::||..||..|||  |.:.|
plant    61 SPSPSKNKPHESKKKSNEAALILIRHGESLWNEKNLFTGCVDVPLTQKGVGEAIEAGK--KISNI 123

  Fly    89 EFDVAHTSVLTRAQETLRAALKSSEHKK---------------------------IPVCTTWRLN 126
            ..|:..||.|.|||.|...|:.....||                           |||...|:||
plant   124 PVDLIFTSSLIRAQMTAMLAMTQHRRKKVPIILHNESVKAKTWSHVFSEETRKQSIPVIAAWQLN 188

  Fly   127 ERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYYACIVEDPRYKDQLKPEEFPK 191
            ||.||.|.||||.|||:::|.::|..||||::.||                            ||
plant   189 ERMYGELQGLNKKETAERYGTQQVHEWRRSYEIPP----------------------------PK 225

  Fly   192 SESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHLECISDKDIMSLNLPTGIPFV 256
            .|||::..||.:.|:.:.|.|::..|..|:|||||||||.::.:|:.::.:::.:|:|.||:|.:
plant   226 GESLEMCAERAVAYFEDNIKPELASGNNVMIAAHGNSLRSIIMYLDDLTSQEVTTLDLSTGVPLL 290

  Fly   257 YELDESLKPLATLKFL--GDP 275
            |...|.       ||:  |.|
plant   291 YIFKEG-------KFMKRGSP 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym87NP_652041.2 gpmA 42..292 CDD:184516 93/266 (35%)
PGMNP_177928.2 HP 79..306 CDD:416258 93/263 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3351
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I1611
OMA 1 1.010 - - QHG61896
OrthoDB 1 1.010 - - D804949at2759
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 1 1.000 - - mtm1064
orthoMCL 1 0.900 - - OOG6_101500
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X392
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.