DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym87 and AT1G22170

DIOPT Version :9

Sequence 1:NP_652041.2 Gene:Pglym87 / 46246 FlyBaseID:FBgn0011270 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001321168.1 Gene:AT1G22170 / 838822 AraportID:AT1G22170 Length:334 Species:Arabidopsis thaliana


Alignment Length:278 Identity:102/278 - (36%)
Similarity:142/278 - (51%) Gaps:67/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SKSSSGGKQAEKKGKYRIVMVRHGESEWNQKNLFCGWFDAKLSEKGQQEACAAGKALKDAKIEFD 91
            ||:.....| :|..:..::::|||||.||:||||.|..|..|:|||.:||..|||.:  :.|..|
plant    64 SKTIPDNSQ-KKSNEAALILIRHGESLWNEKNLFTGCVDVPLTEKGVEEAIEAGKRI--SNIPVD 125

  Fly    92 VAHTSVLTRAQETLRAALKSSEHKK---------------------------IPVCTTWRLNERH 129
            |..||.|.|||.|...|:.....||                           |||...|:||||.
plant   126 VIFTSSLIRAQMTAMLAMIQHRRKKVPIILHDESEQAKTWSQVFSDETKNQSIPVIPAWQLNERM 190

  Fly   130 YGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEYYACIVEDPRYKDQLKPEEFPKSES 194
            ||.|.||||.|||:::|:|:|..||||:|.||                            ||.||
plant   191 YGELQGLNKQETAERYGKEQVHEWRRSYDIPP----------------------------PKGES 227

  Fly   195 LKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVKHLECISDKDIMSLNLPTGIPFVYEL 259
            |::..||.:.|:.:.|.|::..|..|:|||||||||.::.:|:.::.::::||.|.||||.:|..
plant   228 LEMCAERAVAYFQDNIEPKLAAGKNVMIAAHGNSLRSIIMYLDKLTCQEVISLELSTGIPLLYIF 292

  Fly   260 DESLKPLATLKFL--GDP 275
            .|.       ||:  |.|
plant   293 KEG-------KFMKRGSP 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym87NP_652041.2 gpmA 42..292 CDD:184516 98/263 (37%)
AT1G22170NP_001321168.1 HP 78..305 CDD:416258 98/263 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 71 1.000 Domainoid score I3351
eggNOG 1 0.900 - - E1_COG0588
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 163 1.000 Inparanoid score I1611
OMA 1 1.010 - - QHG61896
OrthoDB 1 1.010 - - D804949at2759
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 1 1.000 - - mtm1064
orthoMCL 1 0.900 - - OOG6_101500
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X392
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.740

Return to query results.
Submit another query.