DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pglym87 and bpgm

DIOPT Version :9

Sequence 1:NP_652041.2 Gene:Pglym87 / 46246 FlyBaseID:FBgn0011270 Length:292 Species:Drosophila melanogaster
Sequence 2:NP_001016599.1 Gene:bpgm / 549353 XenbaseID:XB-GENE-981498 Length:259 Species:Xenopus tropicalis


Alignment Length:253 Identity:135/253 - (53%)
Similarity:179/253 - (70%) Gaps:1/253 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 KYRIVMVRHGESEWNQKNLFCGWFDAKLSEKGQQEACAAGKALKDAKIEFDVAHTSVLTRAQETL 105
            ||::||:||||..||.:|.||.|.|.|||..|.:||...||.||....|||:..||:|:|:.:|.
 Frog     3 KYKLVMLRHGEGAWNIENRFCSWVDQKLSADGLREAEECGKKLKSLGFEFDLVFTSILSRSIQTA 67

  Fly   106 RAALKSSEHKKIPVCTTWRLNERHYGGLTGLNKAETAKKFGEEKVKIWRRSFDTPPPPMEKDHEY 170
            ...|:..:.:.:|:.::|||||||||.|.|||:||.|...|||:|||||||:|..|||::..|.|
 Frog    68 WLVLRELDQEWVPIQSSWRLNERHYGALIGLNRAELALNHGEEQVKIWRRSYDVSPPPIDASHPY 132

  Fly   171 YACIVEDPRYKD-QLKPEEFPKSESLKLTIERTLPYWNEVIVPQIKDGMRVLIAAHGNSLRGVVK 234
            |..|..|.||.. .:..|:.|||||||..:||.||||||||.|:||:|.||||:|||||.|.::|
 Frog   133 YQEIHTDRRYTTCDIPKEKLPKSESLKQVLERLLPYWNEVIAPEIKNGKRVLISAHGNSTRALLK 197

  Fly   235 HLECISDKDIMSLNLPTGIPFVYELDESLKPLATLKFLGDPETVKKAMESVANQGKAK 292
            |||.|||.||::::||||:|.:.||||:|.|:...:||||.|.::.|::.|.:|||.|
 Frog   198 HLEGISDSDIVNISLPTGVPVLLELDENLHPVKPHEFLGDQEAIRAAIKKVEDQGKVK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Pglym87NP_652041.2 gpmA 42..292 CDD:184516 133/250 (53%)
bpgmNP_001016599.1 HP 5..253 CDD:386100 130/247 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG61896
OrthoDB 1 1.010 - - D496634at33208
OrthoFinder 1 1.000 - - FOG0000615
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11931
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X392
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.